SecReT6
Protein ID: 22127550
SecReT6 ID34
T6SS typei3
Gene symbol-
Locus tagy3676
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]4084889..4085902 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7CG90
KEGG IDypm:YP_3680, ype:YPO0499, ypk:y3676
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 183..203
Protein Sequence: 337 a.a.     [Download]
>gi|22127550|ref|NP_670973.1| hypothetical protein y3676 [Yersinia pestis KIM10+]
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCF
DLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKT
ARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQ
STESYQLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLD
RILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c4085902-4084889 Yersinia pestis KIM 10 chromosome, complete genome
TTGATTTTAAAACGGATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATG
ATCCGGCCTATGGCGAGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCC
GCATGAACCCCCTCAAATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAGCAATGTTTT
GATTTACGTGTAATGCTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATATCGGCCCTCTATGATG
GCTTTATGCGCATTAATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCC
ATTAAATAGTGGGCATGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACT
GCACGCCTTACAGAAGAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCC
AAGAGAGATATTTTGTTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATT
GCCAGATTTAAAAGACCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAA
TCCACAGAGAGTTACCAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTG
CACAATTGAATGCCCCAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCT
TGATACTCAGTCCTTTAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGAC
CGTATTCTAGAGTACTTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAG
AGATGATAGGTATGGATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACA
GTTTACCGGAAAAACTAACCTACCGTTTCGATGA