SecReT6
Protein ID: 221369478
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3641
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]563494..564588 [+]
ProductImpA domain protein
NoteTssA
UniProt IDB9KTX3
KEGG IDrsk:RSKD131_3641
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-19, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.00E-19, Aligned region: 220..236
Protein Sequence: 364 a.a.     [Download]
>gi|221369478|ref|YP_002520574.1| ImpA domain protein [Rhodobacter sphaeroides KD131]
MSKGRTAMSELREFLDPIEGDAPSGADLRNDPRFHAIERLIEPARRAARQAAAETGSQVQLDWSAIVAEA
RALAASGRDLRLLVILLRALTAEEGLAGLASGLDLLARTVESYWDTLHPALREGPPQEAAMRRVNALRQI
ENADAGLLGDLEFQPMFEMRALGAVTGGDLAAGGLRAAQVLAEAPRGLGARETSEIAAAHEARAARVAAA
CRGLKAERPAEFEGLAAGLAHAQAALGRLEAALAKELGTNGAGLRFTALSTQLQRMAATLGTAAAEPAPL
AAEAPAALPEAPALGIASRRDVERCLDLIIEFYERTEPSSPIPHLARRMRRMVPMNFLQLMEEVAPSGMK
EFRAVAGVADERTK
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|221368938|ref|NC_011958.1|:563494-564588 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
TTGTCGAAAGGCCGCACGGCCATGTCGGAGCTACGGGAATTTCTCGATCCGATCGAAGGCGACGCTCCGT
CGGGTGCGGACCTGCGGAACGATCCGCGCTTTCACGCTATCGAGCGTCTTATCGAACCGGCCCGACGCGC
GGCCCGTCAGGCGGCCGCCGAAACGGGGTCTCAGGTGCAGCTCGACTGGAGCGCCATCGTGGCCGAAGCG
CGCGCGCTTGCGGCCTCGGGGCGCGACCTCCGGCTTCTAGTGATCCTCCTGCGCGCGCTCACCGCCGAGG
AGGGGCTGGCGGGGCTCGCCTCCGGGCTCGACCTGCTGGCCCGGACCGTGGAGAGCTACTGGGACACGCT
CCACCCCGCGCTGCGCGAGGGGCCGCCGCAGGAGGCGGCCATGCGCCGGGTCAATGCGCTGCGCCAGATC
GAGAATGCGGATGCGGGCCTTCTCGGCGATCTCGAGTTCCAGCCGATGTTCGAGATGCGGGCTCTGGGCG
CCGTCACGGGCGGCGACCTTGCGGCGGGCGGCTTGCGCGCGGCGCAGGTGCTGGCCGAGGCCCCGCGCGG
GCTCGGCGCGCGCGAGACCTCCGAGATCGCCGCCGCGCACGAGGCGCGGGCCGCCCGTGTGGCTGCCGCC
TGCCGCGGACTGAAGGCGGAGCGGCCGGCGGAGTTCGAGGGCCTCGCCGCAGGGCTCGCCCATGCACAGG
CGGCCCTCGGCCGGCTCGAGGCGGCGCTGGCGAAAGAGCTCGGCACCAACGGCGCGGGGCTGCGCTTCAC
GGCGCTCTCGACCCAGCTTCAGCGCATGGCCGCGACCCTCGGCACCGCCGCGGCCGAGCCCGCACCGCTC
GCCGCAGAGGCCCCCGCTGCCCTCCCCGAGGCCCCGGCCCTGGGGATCGCCTCGCGCCGCGATGTCGAGC
GCTGCCTCGACCTCATCATCGAGTTCTACGAGCGCACCGAACCCTCGTCGCCGATCCCGCATCTGGCGCG
GCGGATGCGGCGGATGGTGCCGATGAACTTCCTCCAGCTCATGGAGGAGGTCGCCCCCTCGGGCATGAAG
GAATTCCGCGCCGTGGCCGGCGTCGCGGACGAACGGACGAAATGA