SecReT6
Protein ID: 221369479
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3642
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]564607..565137 [+]
Producthypothetical protein
NoteTssB
UniProt IDB9KTX4
KEGG IDrsk:RSKD131_3642
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-53, Aligned region: 9..168
Protein Sequence: 176 a.a.     [Download]
>gi|221369479|ref|YP_002520575.1| hypothetical protein RSKD131_3642 [Rhodobacter sphaeroides KD131]
MSESKAKVIERNRAPRVQIAYDVEHYGSPTTIELPFVMGVMADLAGKSETREAQKPAAERAFVEVDAGRF
GKFMEALSPRVKARVPNRLPGGAEGGEEEMFVDLSFRSMGDFAPDRMAEQVPALAELLRMRRQLEELLGY
MDGKVSAEKRIAQLLTNEPLLAQVAGEAVKSRQAEE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|221368938|ref|NC_011958.1|:564607-565137 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGAGCGAGAGCAAGGCGAAGGTGATCGAACGCAACCGCGCTCCGCGGGTGCAGATCGCCTATGACGTGG
AGCATTACGGCAGCCCGACCACCATCGAGCTGCCCTTCGTGATGGGGGTCATGGCCGACCTCGCCGGCAA
GTCCGAGACGCGCGAGGCGCAGAAGCCCGCGGCCGAGCGGGCCTTCGTCGAGGTGGATGCCGGCCGGTTC
GGCAAGTTCATGGAGGCGCTGAGCCCGCGGGTGAAGGCACGGGTCCCGAACCGGCTGCCCGGCGGCGCGG
AGGGCGGCGAGGAGGAGATGTTCGTCGATCTCAGCTTCCGCAGCATGGGCGATTTCGCCCCCGACCGTAT
GGCCGAGCAGGTGCCAGCACTGGCCGAGCTTCTGCGGATGCGGCGTCAGCTCGAAGAGCTTCTGGGCTAC
ATGGACGGCAAGGTCAGTGCCGAGAAGCGCATCGCCCAGCTTCTGACGAACGAGCCGCTGCTCGCGCAGG
TCGCGGGCGAGGCCGTGAAGTCGCGTCAGGCGGAGGAATGA