SecReT6
Protein ID: 221369480
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3643
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]565134..566651 [+]
Producthypothetical protein
NoteTssC
UniProt IDB9KTX5
KEGG IDrsk:RSKD131_3643
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-178, Aligned region: 71..500
Protein Sequence: 505 a.a.     [Download]
>gi|221369480|ref|YP_002520576.1| hypothetical protein RSKD131_3643 [Rhodobacter sphaeroides KD131]
MTMAEAKQDTGPATAETEALDLGEFSALLEKDFRVREDDSDKLKELVRNLALAATERSGTATISGNAVKS
IKSLIAGIDALLSAQMNEILHAPEVRQIEGTWRGLHYLVNNTETDQKLKIRVMNITKDELADQLEDFEGQ
MWDQSPTFKKLYTEEYSMFGGAPFGAVIGAYEFSHHPRDVSLLRNISGICASAHAPFIAAAAPQLFRMES
WQELPNPQDLQQIVSSPDYASWQSLRESEDSRYIGLTLPRVLARLPYGAATIPVKGFAFEEEIDGKHDHY
VWMNAAFPMGVNINRSHKLYSWGTQIRGVETGGSVINLPVHTFPTDDGSVAMKCPTEIAIDDRREAELAR
LGMMPILHRKNTDIAAFIGAHSLQDDEARAGRLVDPDAQSNERLSANLPYLFPVCRFAHYLKAIARDKIG
SFKERADMQVWLSEWINRYVLANTAMADDKQKARRPLAAAEVQVDSVEGRPGYYAARFYLRPHYQLEGIN
ASLRLVSELPSVKGG
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|221368938|ref|NC_011958.1|:565134-566651 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGACCATGGCCGAAGCCAAGCAGGACACTGGCCCCGCCACCGCCGAGACCGAGGCGCTGGATCTGGGCG
AGTTCAGTGCGCTTCTGGAAAAGGACTTCCGCGTCCGCGAGGACGACAGCGACAAGCTGAAGGAGCTGGT
GCGCAACCTCGCCCTCGCGGCCACCGAGCGGTCGGGCACCGCCACGATCTCGGGCAATGCCGTCAAGTCG
ATCAAGTCGCTGATCGCGGGCATCGACGCGCTCCTCTCGGCGCAGATGAACGAGATCCTCCACGCGCCCG
AGGTGCGCCAGATCGAGGGGACATGGCGCGGGCTCCATTATCTCGTGAACAACACCGAGACCGACCAGAA
GCTGAAGATCCGGGTGATGAACATCACCAAGGACGAACTGGCCGACCAGCTCGAGGATTTCGAGGGCCAG
ATGTGGGACCAGTCGCCCACCTTCAAGAAGCTCTACACCGAGGAATATTCGATGTTCGGCGGCGCGCCCT
TCGGGGCGGTCATCGGAGCCTATGAATTCAGCCACCATCCACGCGACGTGAGCCTCCTGCGCAACATCTC
GGGCATCTGCGCCTCGGCCCATGCGCCCTTCATCGCCGCGGCGGCGCCACAGCTCTTCCGCATGGAGAGC
TGGCAGGAACTGCCCAATCCTCAGGATCTTCAGCAGATCGTCTCCTCGCCCGATTACGCCAGCTGGCAAT
CGCTGCGCGAGAGCGAGGACAGCCGCTACATCGGCCTCACGCTGCCGCGGGTGCTGGCCCGCCTGCCCTA
TGGCGCGGCCACGATCCCGGTGAAGGGCTTCGCCTTCGAGGAAGAGATCGACGGCAAGCACGACCATTAC
GTCTGGATGAACGCGGCCTTCCCGATGGGCGTGAACATCAACCGCAGCCACAAGCTCTACAGCTGGGGCA
CCCAGATCCGCGGCGTCGAGACCGGCGGCTCGGTCATCAACCTGCCCGTCCACACCTTCCCGACCGACGA
CGGTTCGGTGGCGATGAAATGCCCCACCGAGATCGCCATCGACGACCGGCGCGAGGCGGAACTCGCCAGA
CTCGGGATGATGCCGATCCTGCACCGCAAGAACACCGACATTGCGGCCTTCATCGGCGCTCACAGCCTGC
AGGACGACGAGGCCCGCGCCGGACGGCTGGTCGATCCCGACGCGCAGTCGAACGAGCGGCTAAGCGCGAA
CCTGCCCTACCTCTTCCCCGTCTGCCGCTTCGCCCATTACCTCAAGGCCATCGCGCGCGACAAGATCGGC
AGCTTCAAGGAACGGGCCGACATGCAGGTCTGGCTGTCCGAGTGGATCAACCGCTATGTCCTCGCCAACA
CCGCCATGGCGGACGACAAGCAGAAGGCGCGCCGCCCGCTCGCCGCCGCCGAGGTGCAGGTCGACAGCGT
CGAGGGCCGGCCCGGCTACTATGCCGCGCGCTTCTACCTGCGGCCGCACTACCAGCTGGAGGGCATCAAC
GCGAGCCTGCGGCTCGTCTCGGAACTGCCCTCCGTCAAGGGAGGCTGA