SecReT6
Protein ID: 221369481
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3644
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]566703..567194 [+]
Producthypothetical protein
NoteTssD
UniProt IDB9KTX6
KEGG IDrsk:RSKD131_3644
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.10E-36, Aligned region: 6..140
Protein Sequence: 163 a.a.     [Download]
>gi|221369481|ref|YP_002520577.1| hypothetical protein RSKD131_3644 [Rhodobacter sphaeroides KD131]
MAFTGYLKIDDIKGESRRADHEDEIDAFGVSWLVEQTSSASTGSGRTRGRARVGDFRLRKWMDASSPYLA
LACMQGKSFPEMIFMARKDSGEAHLDYLQVTLKNCIVSSYALAQDAPEESGHDMIAEDVAISFETITYKY
VVQADDHSAGDEHEVEYNVVAAR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|221368938|ref|NC_011958.1|:566703-567194 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGGCATTCACAGGCTACCTCAAGATCGACGACATCAAGGGCGAGTCGCGGCGCGCCGACCACGAGGACG
AGATCGACGCCTTCGGCGTGAGCTGGCTCGTCGAGCAGACGAGCTCGGCCTCGACCGGCAGCGGCCGGAC
GCGCGGCCGTGCCAGGGTGGGCGACTTCCGGCTGCGCAAATGGATGGACGCCTCTTCACCCTATCTCGCG
CTGGCCTGCATGCAGGGCAAGTCCTTCCCCGAGATGATCTTCATGGCGCGCAAGGATTCCGGCGAGGCCC
ATCTCGATTATCTGCAGGTGACGCTGAAGAACTGCATCGTCTCGAGCTATGCGCTCGCGCAGGATGCGCC
CGAGGAGTCGGGCCATGACATGATCGCCGAGGATGTGGCGATCTCGTTCGAGACCATCACCTACAAATAT
GTCGTTCAGGCCGACGACCATTCGGCCGGCGACGAGCACGAGGTCGAATATAACGTCGTCGCCGCCCGCT
GA