SecReT6
Protein ID: 221369483
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3646
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]567931..569799 [+]
Producthypothetical protein
NoteTssF
UniProt IDB9KTX8
KEGG IDrsk:RSKD131_3646
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-165, Aligned region: 6..621
Protein Sequence: 622 a.a.     [Download]
>gi|221369483|ref|YP_002520579.1| hypothetical protein RSKD131_3646 [Rhodobacter sphaeroides KD131]
MMDRAFLAYYEAELAELREAAAAFGTLHPTVGRNLSLDTVPCPDPYVERLLEGVAWLAARTRLKLDAEAQ
RSVRNLLDWLWPDLAGPAPAMALATLHPGPQVLGMADGHTVTRGTRLVAAFREGLATRATYTTAQDVTLW
PVTLEAAGYLPDRGALKAAGLSEAMAGGAEAAIRLALTRAGPGTLSELSLDRLDLCFAGSPRAPALFDAI
HGSCRRAAARGAADFERVPAPALVGIDGAEGLLPRLRPSFEGYRLIREYFLMPERFHYLRLDGLQAAIRA
ATGRVEILLLLDRPRPALADLAASDFRLFVTPVVNLFEKECNAVEVDPRSAAHVVHPDRTRPRDFEILRL
LRVEDADSSGPEAVIQPLHAPAAQGGSGLFYTTERRPRRPGEDELRRGQTRTSHAGDDLCISLVRRPGAT
APAVRRLDIRALCTNRDLPILDDSPRLTLESGDPVARVELLSALRRPRPALAAGLPRMTREAEAQQDEVT
WRLAAQLSLDHLSLAETTDDAEPLRALLALYADRGDPAVARHARSIARVQARPVTERLDLPGPLCFGRGQ
EVTLEVDETLLSGASTLLLSALLAQLFARQAAINAVVRLRTRLVQAQEEVTWPTIPGIRPPI
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|221368938|ref|NC_011958.1|:567931-569799 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGATGGACCGCGCCTTCCTCGCCTATTACGAGGCCGAACTGGCCGAGCTGCGCGAGGCGGCGGCCGCGT
TCGGCACCCTGCATCCGACGGTGGGGCGCAACCTCTCGCTCGATACGGTGCCCTGCCCGGACCCTTACGT
GGAACGGCTGCTCGAGGGGGTGGCCTGGCTCGCGGCAAGGACCCGGCTCAAGCTCGACGCCGAGGCGCAG
CGCAGCGTGCGCAACCTGCTCGACTGGCTCTGGCCCGACCTCGCCGGGCCCGCGCCGGCCATGGCGCTCG
CCACCCTTCACCCGGGGCCGCAGGTGCTGGGGATGGCGGACGGCCACACGGTGACGCGCGGCACCCGCCT
CGTCGCGGCCTTCCGCGAGGGGCTGGCCACACGCGCCACCTACACGACCGCGCAGGACGTCACCCTCTGG
CCGGTGACCCTCGAGGCGGCGGGATACCTGCCCGACCGCGGCGCCTTGAAGGCCGCGGGGCTCTCCGAGG
CGATGGCGGGGGGCGCCGAGGCGGCCATCCGCCTAGCCCTCACGCGCGCAGGGCCGGGCACGCTCTCCGA
GCTGTCGCTCGACCGGCTCGACCTCTGTTTCGCGGGCAGTCCGCGCGCGCCCGCGCTGTTCGACGCGATC
CACGGCTCCTGTCGGCGGGCGGCGGCCCGCGGCGCGGCGGATTTCGAGCGGGTGCCGGCCCCTGCCCTCG
TAGGGATCGACGGGGCGGAGGGCCTGCTGCCGCGCCTGCGCCCCTCCTTCGAGGGCTACCGGCTCATCCG
CGAATATTTTCTGATGCCGGAGCGGTTCCACTACCTGCGCCTCGACGGGCTGCAGGCGGCCATCCGCGCG
GCGACGGGACGGGTCGAGATCCTGTTGCTCCTCGACCGTCCGCGGCCGGCGCTGGCGGACCTCGCGGCCT
CGGACTTCCGGCTGTTCGTGACGCCCGTGGTCAATCTCTTCGAGAAGGAATGCAACGCGGTCGAGGTCGA
TCCCCGCTCGGCCGCGCATGTCGTGCACCCGGACCGCACAAGGCCGCGCGACTTCGAGATCCTGCGCCTG
CTGCGGGTCGAGGATGCCGACAGCTCCGGCCCCGAGGCGGTGATCCAGCCCCTCCATGCGCCCGCGGCGC
AAGGGGGCTCGGGCCTCTTCTACACCACCGAGCGCCGCCCCCGCCGCCCCGGCGAGGACGAGCTGCGCCG
GGGCCAGACCCGCACGAGCCACGCGGGCGACGATCTCTGCATTTCGCTCGTGCGGCGTCCGGGCGCGACG
GCGCCTGCCGTCCGGCGGCTCGACATCCGCGCGCTCTGCACCAACCGCGACCTGCCGATCCTCGACGACA
GCCCGCGCCTCACGCTCGAAAGCGGCGATCCGGTGGCGCGGGTCGAGCTTCTGTCGGCACTCCGCCGCCC
CCGTCCCGCGCTGGCCGCCGGGCTGCCGCGCATGACCCGCGAAGCGGAGGCGCAGCAGGACGAGGTCACC
TGGCGCCTCGCCGCGCAGCTCTCGCTCGATCATCTGTCGCTCGCCGAGACGACCGACGACGCCGAACCGC
TGCGCGCGCTGCTCGCGCTCTATGCCGACCGCGGCGACCCGGCCGTGGCCCGCCATGCGCGGTCCATCGC
CCGGGTGCAGGCGCGCCCCGTGACCGAGCGGCTGGATCTGCCCGGCCCGCTGTGCTTCGGCCGCGGACAG
GAGGTGACGCTCGAGGTCGACGAGACGCTGCTGAGCGGGGCGAGCACGCTTCTTCTGTCCGCGCTGCTCG
CGCAGCTCTTCGCGCGGCAGGCGGCGATCAACGCGGTCGTCCGGCTGCGCACGCGGCTGGTTCAGGCACA
GGAGGAGGTGACATGGCCGACGATCCCCGGCATCCGCCCCCCGATCTGA