SecReT6
Protein ID: 221369484
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3647
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]569898..570761 [+]
Producthypothetical protein
NoteTssG
UniProt IDB9KTX9
KEGG IDrsk:RSKD131_3647
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-63, Aligned region: 2..263
Protein Sequence: 287 a.a.     [Download]
>gi|221369484|ref|YP_002520580.1| hypothetical protein RSKD131_3647 [Rhodobacter sphaeroides KD131]
MRLSMAARDVAALRPGAPPFVEVEVLGLLGPEGPMPLHLTRWLMQRLSDRWFEGKDGGTADTTALDFLNM
IQHRLLTLYWRAWADQRPEVQAAFGTGRLGAMIDALAGLGLPGPRPARLDGVKRRHATSLASGIQSPARL
TDLVACHLGAPTTLREFLPHWMPIPPPLQSRLGRQHARLGRGAVAGARSFQRQTRAELRVGPVDLPLYLR
LIEDPALAADLRHLVGVAAPREVTVGLRPLLRRAAIPAPHLGSVRLGRTLWLAGGRHRDAEDWRRPSLLP
AGGEAGC
 
Nucleotide Sequence: 864 bp     [Download]
>gi|221368938|ref|NC_011958.1|:569898-570761 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGCGGCTGTCGATGGCGGCGCGCGACGTGGCGGCGCTGCGCCCCGGCGCGCCGCCCTTCGTCGAGGTCG
AGGTGCTGGGCCTTCTCGGCCCCGAGGGGCCGATGCCGCTGCATCTCACGCGCTGGCTGATGCAGCGCCT
GTCCGACCGCTGGTTCGAGGGCAAAGACGGCGGCACCGCCGATACGACGGCGCTCGATTTCCTCAACATG
ATCCAGCATCGGCTGCTCACGCTCTACTGGCGCGCCTGGGCCGACCAGAGGCCCGAGGTGCAGGCAGCCT
TCGGCACGGGGCGGCTCGGGGCCATGATCGACGCCCTTGCCGGTCTGGGCCTGCCCGGGCCGCGGCCTGC
CCGTCTCGACGGGGTGAAGCGGCGGCACGCGACCTCGCTCGCCTCCGGGATCCAGAGCCCCGCGCGGCTG
ACGGATCTGGTGGCCTGCCATCTTGGCGCGCCAACCACGCTTCGTGAATTTCTGCCGCACTGGATGCCGA
TCCCGCCGCCGCTGCAGAGCCGGCTCGGCCGCCAGCACGCCCGCCTCGGCCGCGGCGCGGTGGCCGGGGC
GCGCAGCTTCCAGCGCCAGACCCGGGCCGAGCTGCGCGTGGGGCCGGTGGATCTGCCGCTCTACCTGCGC
CTGATCGAGGATCCGGCCCTCGCCGCCGACCTGCGCCATCTGGTGGGCGTGGCCGCCCCGCGCGAGGTGA
CGGTGGGGCTGCGGCCCCTCCTGCGGCGCGCGGCGATCCCCGCGCCGCACCTCGGCTCGGTGCGGCTCGG
CCGGACGCTCTGGCTGGCGGGCGGCCGCCACCGCGACGCCGAAGACTGGCGGCGGCCGAGCCTTCTTCCC
GCAGGGGGAGAGGCCGGATGCTGA