SecReT6
Protein ID: 221369485
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3648
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]570755..571984 [+]
ProductFHA domain containing protein precursor
NoteFha
UniProt IDB9KTY0
KEGG IDrsk:RSKD131_3648
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.10E-12, Aligned region: 26..94
Protein Sequence: 409 a.a.     [Download]
>gi|221369485|ref|YP_002520581.1| FHA domain containing protein precursor [Rhodobacter sphaeroides KD131]
MLRLVIEHAPCPQRVGEMRLEAGELSIGRGADCDWQIDDPDMFVSRRHCIVSGGEGGWRVIDASRGGLFL
DGSESPLGAGNSAVLAQGTRLRLGDVVLRAEIEGREPLRAPPAPREAALAVDDFFASPRAVTPEPPPRPK
DLPGPFEAVERAPAPPPQDDFGFGWALPAGSRPAPTEARATEGQDPFFRPGTATETPSAGASPAPPQAMS
APREVALSEDALSEAFFRGLGLPSETLDAAGMEAMGRRFRLLAEGLVLLLRARAREKGAARVPQSVIGAS
EVNPLKFLVTLDEAVAALVTPRGPGYLGPEASIEGAFRDLTDHQLRNWIAVQAALRRMIDRFDPARFEAE
SEREGRMAQLLAGGRSARLWQLYLDRYEELARAAEDRFLGEVGADFREAYEGPERRENG
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|221368938|ref|NC_011958.1|:570755-571984 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGCTGAGGCTCGTCATCGAACATGCGCCCTGCCCGCAGCGCGTGGGCGAGATGCGGCTCGAGGCGGGCG
AACTCTCGATCGGGCGCGGTGCCGACTGCGACTGGCAGATCGACGACCCGGACATGTTCGTCTCGCGCAG
GCATTGCATCGTCTCGGGCGGCGAGGGCGGCTGGCGGGTGATCGACGCAAGCCGGGGCGGGCTCTTCCTC
GACGGATCCGAAAGCCCGCTCGGCGCGGGAAATTCCGCGGTGCTGGCGCAGGGCACCCGGCTCCGGCTGG
GCGATGTCGTGCTGCGGGCCGAGATCGAGGGGCGCGAGCCCCTGCGCGCGCCGCCCGCCCCGCGCGAGGC
GGCGCTGGCGGTCGACGATTTCTTCGCGTCGCCGCGCGCGGTGACGCCCGAGCCTCCGCCGCGGCCGAAG
GATCTTCCGGGACCGTTCGAGGCGGTGGAGCGGGCGCCCGCCCCGCCGCCGCAGGATGACTTCGGCTTCG
GGTGGGCCCTGCCCGCGGGGTCCCGCCCAGCCCCCACCGAGGCGCGTGCCACGGAAGGACAGGACCCGTT
CTTCAGGCCGGGCACCGCGACGGAGACCCCTTCCGCGGGAGCATCCCCGGCCCCGCCGCAGGCGATGTCC
GCGCCAAGAGAGGTCGCCTTGTCGGAGGACGCCCTGTCCGAGGCCTTCTTCCGCGGCCTGGGCCTTCCGT
CCGAGACCCTCGACGCGGCGGGGATGGAGGCGATGGGCCGCCGCTTCCGGCTGCTGGCCGAGGGGCTCGT
CCTCTTGCTGCGCGCCCGCGCCCGCGAGAAGGGCGCCGCCCGCGTGCCGCAGAGCGTGATCGGGGCCTCG
GAGGTCAACCCGCTGAAATTCCTCGTCACGCTCGACGAGGCGGTGGCCGCGCTGGTGACGCCGCGGGGGC
CGGGATATCTCGGCCCCGAGGCTTCCATCGAGGGCGCCTTCCGCGACCTCACCGATCATCAGCTGCGCAA
CTGGATCGCGGTGCAGGCCGCGCTGCGCCGGATGATCGACCGGTTCGATCCCGCGCGCTTCGAGGCCGAG
AGCGAGCGCGAGGGCCGGATGGCGCAGCTTCTCGCCGGAGGCCGCAGCGCGCGGCTCTGGCAGCTGTATC
TCGACCGTTACGAAGAGCTCGCCCGCGCGGCCGAGGACCGGTTCCTCGGCGAGGTCGGGGCCGATTTCAG
GGAGGCCTACGAGGGCCCGGAGAGGAGAGAGAATGGCTGA