SecReT6
Protein ID: 221369486
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3649
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]571992..572429 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB9KTY1
KEGG IDrsk:RSKD131_3649
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-24, Aligned region: 10..138
Protein Sequence: 145 a.a.     [Download]
>gi|221369486|ref|YP_002520582.1| hypothetical protein RSKD131_3649 [Rhodobacter sphaeroides KD131]
MFLAGAGALLLVVGCGGPKAGTLTVSATGTAGMNPGPDGSDRPLTVQILQLRGTAAFDAADAFALQSPAT
SLGADLLKADLVTLMPGAPVVRAIPLDPSVAAIGVVAGFRSAGGRSYRYSFSVAPTAEVALKIDVGQGGL
VVVQG
 
Nucleotide Sequence: 438 bp     [Download]
>gi|221368938|ref|NC_011958.1|:571992-572429 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGTTCCTTGCGGGCGCGGGGGCGCTTTTGCTCGTGGTGGGCTGCGGGGGGCCCAAGGCCGGCACGCTCA
CCGTCAGCGCCACCGGCACGGCGGGCATGAACCCCGGCCCCGACGGGAGCGACCGGCCGCTGACGGTCCA
GATCCTGCAGCTGCGCGGCACCGCGGCCTTCGACGCGGCCGACGCCTTCGCGCTCCAGTCGCCGGCGACG
AGCCTCGGCGCGGACCTGCTCAAGGCGGATCTCGTGACGCTGATGCCGGGCGCGCCGGTCGTGCGGGCGA
TCCCGCTCGACCCGTCGGTGGCGGCCATTGGCGTGGTCGCGGGCTTCCGCAGCGCGGGCGGACGCAGCTA
CCGCTACAGCTTCAGCGTCGCGCCCACCGCCGAGGTGGCGCTGAAGATCGACGTGGGCCAGGGGGGCCTC
GTCGTGGTGCAGGGCTGA