SecReT6
Protein ID: 221369487
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3650
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]572438..573766 [+]
Producthypothetical protein
NoteTssK
UniProt IDB9KTY2
KEGG IDrsk:RSKD131_3650
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-116, Aligned region: 18..440
Protein Sequence: 442 a.a.     [Download]
>gi|221369487|ref|YP_002520583.1| hypothetical protein RSKD131_3650 [Rhodobacter sphaeroides KD131]
MSGNRVVWSEGLFLRTQHFQQQDRHAEALLRAALLAAPWQPFGFTRLALDAAALDAGRVALAEAEALMPD
GTAFRLAEAEPPPAAALRRDGPPGLVQLALPLEQEGAASVDPAHAAPSGARYRGRIEVLRDAIRGGAEPE
EVELARLAPRLIAPGEPADGCVTLPVARVEGLRADGSVALQEGWLPPALTIGAVPWYGALLQELVTGLDR
VADAHGGLVLGGAGRSIENLLILELANTARPRLAHLLQQAQEHPSALYAELAALAGRMATYGSSSRRLSA
LAPYDHLEPQPAFAALADTLRSLLLSLRHVEPKSRALPVARHAQNIWKVRIDNPEILRSSRIVLRVGSEM
SDESLRRLFADQATVGAADAFERLWTSRLPGIPLKPLHSQPREIPYDGERLCLELDQKSEHWSQLLEAPG
FVVGVSGVLEREPQIDCYAVSR
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|221368938|ref|NC_011958.1|:572438-573766 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGAGCGGCAACAGGGTGGTCTGGTCGGAAGGGCTCTTCCTCAGGACCCAGCACTTCCAGCAGCAGGACC
GGCACGCCGAGGCGCTGTTGCGCGCGGCGCTCCTTGCGGCGCCCTGGCAGCCCTTCGGCTTCACGAGGCT
CGCGCTCGATGCGGCGGCGCTCGACGCAGGCCGCGTGGCGCTCGCCGAGGCGGAGGCGCTGATGCCGGAC
GGCACGGCCTTCCGCCTGGCCGAGGCCGAACCGCCGCCGGCCGCGGCGCTCCGCCGCGACGGGCCGCCGG
GCCTCGTCCAGCTGGCGCTGCCGCTCGAGCAGGAGGGGGCGGCGAGTGTCGATCCCGCCCATGCCGCACC
CTCGGGAGCGCGCTACCGGGGGCGGATCGAGGTGCTGCGCGATGCGATCCGCGGGGGCGCCGAGCCCGAG
GAGGTGGAACTCGCGCGGCTCGCCCCGCGCCTGATCGCGCCGGGAGAGCCCGCGGACGGATGCGTGACGC
TGCCCGTGGCGCGCGTCGAGGGGCTGCGCGCGGACGGATCCGTGGCCCTGCAGGAGGGATGGCTGCCCCC
TGCCCTCACCATCGGCGCCGTGCCGTGGTATGGCGCGCTGCTTCAGGAGCTGGTGACGGGGCTCGACCGG
GTGGCCGATGCCCATGGCGGGCTCGTGCTGGGCGGCGCCGGGCGCTCGATCGAGAACCTGCTGATCCTCG
AACTGGCCAACACCGCGCGCCCGCGCCTCGCCCATCTGCTCCAGCAGGCGCAGGAGCATCCCTCGGCGCT
CTATGCCGAGCTGGCCGCGCTCGCCGGACGGATGGCGACCTACGGCTCCTCCTCGCGCCGGCTGAGCGCG
CTTGCGCCCTACGACCATCTCGAGCCGCAACCGGCCTTCGCGGCTCTGGCCGACACGCTGCGCTCGCTTC
TTCTATCGCTGCGCCATGTCGAGCCGAAGTCGCGCGCGCTGCCGGTGGCGCGCCACGCGCAGAACATCTG
GAAGGTCCGCATCGACAATCCCGAGATCCTGCGCTCGTCGCGCATCGTGCTGCGCGTGGGCTCGGAGATG
TCGGACGAGAGCCTGCGCCGGCTCTTCGCCGATCAGGCAACGGTGGGCGCGGCCGATGCCTTCGAGCGGC
TCTGGACCTCGCGCCTGCCGGGCATCCCGCTGAAGCCGCTCCATTCCCAGCCGCGCGAGATCCCCTACGA
CGGCGAGCGGCTCTGCCTCGAACTCGACCAGAAATCCGAGCACTGGTCGCAGTTGCTCGAGGCGCCAGGC
TTCGTGGTGGGGGTTTCGGGCGTGCTCGAGCGCGAGCCGCAGATCGATTGCTATGCGGTGAGCCGATGA