SecReT6
Protein ID: 221369488
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3651
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]573831..575192 [+]
ProductOmpA/MotB domain protein precursor
NoteTssL
UniProt IDB9KTY3
KEGG IDrsk:RSKD131_3651
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.80E-53, Aligned region: 55..260
OmpA [PF00691], Evalue: 9.00E-15, Aligned region: 341..443
Protein Sequence: 453 a.a.     [Download]
>gi|221369488|ref|YP_002520584.1| OmpA/MotB domain protein precursor [Rhodobacter sphaeroides KD131]
MTREDDPFGLATDAARTRIRPSPAERARRAAAGPAPAEVGAVAPVRPAHGRTHPNPLVASFAVLLELAPA
LEGTAPPQEPGMLRARLRDGLTEARDRSVAQGVPLARADRAAWFVAALLDDLALNTPWGAASGWPRQPLV
TELSGEVDAGTRFFDRLEELARHPTLDPQLLELAWLCLSLGFRGKHRTGREGGESALFALRTGVARLLRN
PEAAAAPLSPHWEGVAAPDAPRRFAMPAWTVGLAALALMAALYTGLSLQLSARAEKLFDLAALVPPVERA
ALFRPPRETVAPPPEIRVEPVVIELLPAFRARAPAATAAALQGREDAQLTILTLQGTDPELFRSARAEVN
PDYAPLVASVAAVLAENRELVGAVRVIGHTDNVPVQRSNPFASNQGLSEARAATLAALLVEGGVPAGIVT
AEGHADTEPVADNATRAGRAQNRRVEIRIEKRL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|221368938|ref|NC_011958.1|:573831-575192 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGACGCGGGAGGACGATCCGTTCGGTCTGGCGACCGATGCCGCCCGCACCCGGATCCGGCCCTCTCCCG
CCGAACGGGCGCGCCGGGCCGCAGCCGGGCCCGCTCCGGCCGAGGTGGGCGCCGTGGCCCCGGTCCGCCC
GGCCCACGGGAGGACCCATCCCAATCCGCTCGTCGCGAGCTTCGCCGTCCTGCTCGAACTCGCGCCTGCG
CTGGAAGGCACCGCCCCGCCGCAGGAGCCGGGGATGCTGCGTGCGCGGCTCCGCGACGGCCTGACCGAGG
CCCGCGACCGAAGCGTGGCGCAGGGCGTGCCGCTGGCCCGCGCCGACCGCGCCGCCTGGTTCGTGGCGGC
GCTCCTCGACGATCTGGCCCTGAACACGCCCTGGGGTGCGGCCAGCGGATGGCCGCGCCAGCCGCTCGTG
ACCGAGCTGTCGGGCGAGGTCGATGCGGGCACCCGCTTCTTCGACCGCCTCGAAGAGCTCGCGCGCCATC
CGACGCTCGACCCGCAGCTGCTGGAGCTGGCCTGGCTCTGCTTGTCGCTCGGCTTTCGCGGCAAGCACCG
CACGGGGCGCGAGGGCGGCGAGAGCGCGCTCTTCGCGCTCCGCACCGGCGTGGCGCGCCTTCTGCGCAAT
CCGGAGGCCGCGGCCGCGCCGCTCTCGCCGCACTGGGAGGGGGTCGCGGCGCCCGACGCGCCGCGCCGCT
TCGCGATGCCGGCCTGGACGGTGGGCCTTGCGGCGCTTGCGCTGATGGCGGCCCTCTACACGGGCCTCTC
GCTGCAGCTGTCGGCGCGGGCCGAGAAGCTCTTCGATCTGGCGGCCCTCGTGCCCCCGGTTGAGCGCGCG
GCCCTGTTCCGCCCCCCGCGCGAGACGGTCGCGCCGCCGCCCGAGATCCGGGTGGAGCCAGTGGTGATCG
AGCTTCTGCCCGCCTTCCGGGCCCGCGCCCCCGCCGCCACCGCGGCCGCCCTTCAGGGCCGCGAGGATGC
GCAGCTCACCATCCTCACGCTGCAGGGAACCGATCCCGAGCTGTTCCGCTCGGCCCGCGCCGAGGTGAAC
CCGGACTATGCACCGCTGGTGGCCTCGGTCGCGGCCGTCCTCGCCGAGAACCGCGAGCTGGTGGGGGCAG
TCCGTGTCATCGGCCATACGGACAATGTGCCGGTCCAGCGCAGCAATCCCTTCGCCTCGAACCAGGGCCT
GTCCGAGGCCCGCGCCGCCACTCTCGCGGCCCTCCTCGTCGAGGGCGGCGTGCCCGCGGGGATCGTCACC
GCCGAAGGCCATGCCGACACCGAGCCGGTCGCCGACAATGCCACGCGCGCGGGCCGGGCGCAGAACCGCC
GCGTCGAGATCCGCATCGAGAAGAGGCTCTGA