SecReT6
Protein ID: 221369491
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3654
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]579206..581509 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB9KTY6
KEGG IDrsk:RSKD131_3654
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-78, Aligned region: 27..325
Phage_GPD [PF05954], Evalue: 2.30E-78, Aligned region: 572..617
Phage_base_V [PF04717], Evalue: 1.10E-24, Aligned region: 200..217
Phage_base_V [PF04717], Evalue: 1.10E-24, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 500..521
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 531..554
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 556..577
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 580..594
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 598..618
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 624..642
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 644..666
Gp5_C [PF06715], Evalue: 9.30E-17, Aligned region: 676..692
Protein Sequence: 767 a.a.     [Download]
>gi|221369491|ref|YP_002520587.1| Rhs element Vgr protein [Rhodobacter sphaeroides KD131]
MSEAREITLSLPAATEDLWFSALEGEDGLGRPFRYELLLASKSLDLAAADILGTPVLVTVRGEVPRHFHG
IATAFGLDEIRDDHAHYRLTMEPSMALLGLRRDNRIFQDRSVPEILEAVLSEIPGLDWDFRLQASYPPRD
YCVQYGETDLDFVQRLMEHEGIGYFFEHEAEGHRLVLFDTNARLAPAPGAEILPYEPDSRVSFRDGDFIT
AWLPRAHIRPGKVSHGDYDFEKPSSDLTSRAENPLGHAADDAEHYRWPGDYRTLPAGDRLSRLRLEEAQA
PQVRVEARGTARPLWPGRTFRLDLFPREAENDDYLVTACRYRLWDDQLRSGQSRAEVGYEVDLSLVPARV
PYRPERRTPRPVMKGPQTALVVGPAGAEIFTDRYARVKVHFFWDRLDARNEASSCFVRVSQTWAGAGWGF
IQIPRIGQEVIVDFIEGDPDRPIVTGRVYNAEQMPPYGLPGQATQSGWKSHSSPGGGGWNELRFEDKAGA
EEVYFQAQKDHTELIKNDESRTIGHDFAEDVGHDAVQSVAHDRRESVGNDKDTSVGRNRTVSIGVDDSES
VGANRALRVGADETIAVARNATETIGMNHTQTVGIAQTVTVGAARTDSVGGAETRSVGAVQTNTIAASRS
VSVGAGQTHSVGADDGWTVGGSQTVSVGADQSVTVGAKQTVSTGSDQVTTVGGSRATQVAKDDLQKADGA
MGIGVGKSYTLDVKDEITLKCGSAEITLKKDGTIVVKGKDITLDASGKINLKAGGEITGKGSKINLN
 
Nucleotide Sequence: 2304 bp     [Download]
>gi|221368938|ref|NC_011958.1|:c581509-579206 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGTCCGAGGCCCGCGAAATCACCCTGTCCCTCCCCGCCGCGACCGAGGATCTGTGGTTCTCGGCGCTCG
AGGGCGAGGACGGGCTGGGGCGCCCGTTCCGCTACGAGCTGCTCCTCGCCAGCAAGTCGCTCGATCTCGC
CGCGGCCGACATCCTCGGCACGCCGGTGCTGGTGACGGTGCGGGGCGAGGTGCCGCGCCATTTCCACGGC
ATTGCCACCGCCTTCGGGCTCGACGAGATCCGCGACGACCACGCCCACTACCGGCTGACGATGGAGCCCT
CCATGGCGCTCCTCGGCCTGCGGCGCGACAACCGGATCTTCCAGGACCGGTCGGTGCCCGAGATCCTCGA
GGCCGTCCTGAGCGAGATCCCCGGCCTCGACTGGGATTTCAGGCTGCAGGCCAGCTATCCGCCGCGCGAC
TACTGCGTGCAGTATGGCGAAACCGATCTCGATTTCGTGCAGCGGCTGATGGAGCACGAGGGGATCGGCT
ATTTCTTCGAGCATGAGGCAGAGGGCCACAGGCTCGTCCTCTTCGACACGAATGCCCGCCTCGCGCCTGC
ACCGGGGGCCGAGATCCTGCCCTACGAGCCCGACAGCCGGGTGAGCTTCCGCGACGGCGACTTCATCACC
GCCTGGCTGCCCCGGGCGCATATCCGGCCGGGGAAGGTCTCGCACGGCGACTACGATTTCGAGAAGCCCT
CGTCGGACCTGACGAGCCGCGCCGAAAATCCGCTCGGCCATGCGGCCGACGATGCCGAGCACTATCGCTG
GCCCGGGGATTACCGCACCCTTCCCGCGGGCGACCGGCTGTCCCGGCTCCGGCTCGAGGAGGCGCAGGCC
CCGCAGGTGCGCGTCGAGGCCCGCGGCACCGCGCGGCCGCTCTGGCCGGGCCGGACCTTCCGGCTGGATC
TTTTCCCGCGCGAGGCGGAGAACGACGACTATCTCGTCACCGCCTGCCGCTACCGGCTCTGGGACGACCA
GCTCCGCTCGGGTCAGTCGCGCGCCGAGGTGGGCTACGAGGTGGATCTCTCGCTCGTCCCCGCCCGCGTC
CCCTACCGGCCCGAGCGGCGCACCCCGCGCCCGGTGATGAAGGGGCCGCAGACCGCCCTCGTGGTCGGGC
CAGCGGGCGCGGAGATCTTCACCGACAGATATGCGCGGGTGAAGGTGCATTTCTTCTGGGACCGGCTCGA
CGCCCGCAACGAGGCCTCCTCCTGCTTCGTCCGCGTGAGCCAGACCTGGGCCGGGGCCGGCTGGGGCTTC
ATCCAGATCCCCCGGATCGGTCAGGAGGTGATCGTCGATTTCATCGAGGGCGACCCCGACCGGCCCATCG
TCACGGGCCGGGTCTACAATGCCGAGCAGATGCCGCCCTACGGCCTGCCGGGCCAGGCCACCCAGTCGGG
CTGGAAGTCGCACTCCTCGCCCGGAGGCGGCGGCTGGAACGAGCTGCGCTTCGAGGACAAGGCGGGCGCG
GAGGAAGTCTATTTCCAGGCGCAGAAGGACCATACCGAGCTCATCAAGAACGATGAAAGCCGCACCATCG
GCCATGATTTCGCCGAGGATGTGGGCCATGACGCCGTGCAGTCCGTGGCGCACGACCGCAGGGAGAGCGT
GGGCAACGACAAGGACACGAGCGTGGGTCGCAACCGCACCGTCTCGATCGGCGTCGACGACAGCGAGAGC
GTGGGCGCGAACCGCGCGCTGCGGGTCGGCGCGGACGAGACGATCGCGGTGGCGCGGAATGCGACCGAGA
CCATCGGCATGAACCACACCCAGACGGTCGGCATCGCCCAGACGGTGACGGTCGGGGCGGCGCGCACCGA
CAGCGTCGGCGGGGCCGAGACGCGCTCGGTCGGCGCGGTCCAGACCAACACCATCGCCGCAAGCCGCAGC
GTTTCGGTCGGTGCGGGCCAGACCCATTCGGTGGGCGCCGACGACGGCTGGACCGTGGGCGGGTCGCAGA
CCGTCTCGGTCGGCGCGGACCAGTCGGTGACAGTGGGGGCGAAACAGACGGTCAGCACCGGCTCGGATCA
GGTGACCACCGTCGGCGGCTCCCGCGCCACGCAGGTGGCCAAGGACGACCTGCAGAAGGCCGATGGCGCC
ATGGGCATCGGCGTGGGCAAGAGCTACACGCTCGACGTCAAGGACGAGATCACCCTGAAATGCGGCTCGG
CCGAGATCACGCTGAAGAAGGACGGGACCATCGTCGTGAAGGGCAAGGACATCACGCTGGACGCTTCGGG
CAAGATCAACCTCAAGGCGGGCGGCGAGATCACCGGCAAGGGCTCGAAGATCAACCTGAACTGA