SecReT6
Protein ID: 221369495
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3658
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]585675..586439 [+]
ProductOmpA/MotB domain protein precursor
NoteTagL
UniProt IDB9KTZ0
KEGG IDrsk:RSKD131_3658
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.80E-16, Aligned region: 152..245
Protein Sequence: 254 a.a.     [Download]
>gi|221369495|ref|YP_002520591.1| OmpA/MotB domain protein precursor [Rhodobacter sphaeroides KD131]
MACRATLTRRICALLLAGLAAAPTGAGAEGLTDAELLGLFHRQRDAFAAARSGNGQARGLKLVTVDRIGP
APAVADVPNSLGAPAGEDPGLRPTASTDGAPGETGRPVLGLPQGADRLAAADPPPEGRETAEVTPESFGL
LDPALQVNVRIHFAFDSAVLASDQTPLLAQLCTVMKASDIRLFQIVGHTDAAGSEAYNQQLSLLRAEEVR
RYLTGPCGIAPERLRAVGMGERFLTNQSDPRSGENRRVEFQALS
 
Nucleotide Sequence: 765 bp     [Download]
>gi|221368938|ref|NC_011958.1|:585675-586439 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGGCCTGCCGAGCGACCCTGACGCGCCGGATCTGCGCGCTTCTTCTGGCGGGCCTCGCCGCTGCCCCGA
CCGGGGCCGGCGCAGAGGGTCTGACCGATGCGGAGCTTCTTGGGCTCTTCCACCGGCAGCGCGACGCCTT
CGCGGCGGCCCGGAGCGGCAATGGTCAGGCGCGCGGGCTGAAGCTCGTGACGGTGGACCGGATCGGGCCG
GCGCCCGCCGTGGCCGATGTGCCGAACAGCCTCGGGGCGCCCGCGGGCGAGGATCCTGGCCTTCGGCCGA
CGGCCTCGACCGACGGCGCGCCGGGCGAGACCGGGCGGCCGGTCCTCGGCCTGCCGCAGGGGGCCGACCG
GCTGGCCGCCGCGGATCCGCCGCCCGAGGGGCGTGAGACGGCGGAAGTCACTCCTGAGAGCTTCGGCCTT
CTCGATCCGGCGCTGCAGGTCAATGTGCGCATCCATTTCGCCTTCGACTCCGCGGTGCTGGCGTCGGATC
AGACGCCGCTTCTCGCGCAGCTCTGCACGGTGATGAAGGCGAGCGACATCCGCCTGTTTCAGATCGTGGG
CCACACCGATGCGGCGGGCAGCGAGGCCTACAACCAGCAGCTCTCGCTCCTGCGGGCCGAGGAGGTGCGC
CGCTATCTGACCGGCCCCTGCGGCATCGCGCCGGAACGGCTGCGCGCCGTGGGGATGGGCGAGCGGTTCC
TGACCAACCAGAGCGATCCGCGCAGCGGCGAGAATCGGCGGGTCGAGTTTCAGGCGCTGAGCTAG