SecReT6
Protein ID: 222106980
SecReT6 ID329
T6SS typei5
Gene symbolimpJ
Locus tagAvi_6043
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1061371..1062711 [-]
Producthypothetical protein
NoteTssK
UniProt IDB9K2F7
KEGG IDavi:Avi_6043
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-153, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|222106980|ref|YP_002547771.1| hypothetical protein Avi_6043 [Agrobacterium vitis S4]
MRHENRVAWTEGMFLRVQHFQQSDRWTERLVRSVARSLTPYPWGILEIGLDRSALAIGQFALSGLRGMLP
DGTPFDAPEDTDLPAALELDESVKNAVIYLALPARQPGKADMAQTGTSAVNSVRLVASPYEAPDANVETD
FLAPIDVGRLNLKLLKTGDDLAGYELLGLARVVEVRSDKAVLLDPDFIPASLNCTASSRLHELMTELLGI
VRHRAEAIAERIGDPTIRGTAEVGDYFLLQILNRADPLLKHALSNATRLHPIQFYEQCIQLAGELATFTM
ESKRATDFPAYRHDDLKATFGAVFEDLRTSLSSVLAQSAVAIELVERRHGVRVGTINDRSLLRDAGFVLA
VRADMSAEDVRRTLPARIKVGPVERIAELVNVALPGIPVRPLPVLPRQLPYRAGTIYFELDTKTPLWKQL
ETSGAIALHLAGDFPGLELEMWALRE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1062711-1061371 Agrobacterium vitis S4 chromosome 2, complete genome
ATGAGACATGAAAACCGGGTTGCCTGGACCGAAGGCATGTTCCTTCGCGTCCAACATTTCCAGCAGTCCG
ACCGCTGGACGGAGCGTCTGGTGCGCTCGGTGGCGCGCAGCCTTACGCCTTATCCCTGGGGTATTCTGGA
GATTGGCCTCGACCGCAGCGCCCTTGCCATCGGCCAGTTCGCCCTGTCGGGCCTGCGTGGCATGCTGCCG
GATGGCACACCCTTCGATGCGCCTGAGGATACCGACCTGCCAGCAGCCCTTGAGCTGGACGAATCCGTCA
AGAACGCGGTGATCTATCTGGCCCTTCCCGCCCGCCAGCCCGGCAAGGCTGACATGGCCCAGACCGGCAC
CTCGGCGGTCAACAGTGTGCGGCTTGTTGCTTCACCCTATGAAGCGCCGGATGCCAATGTGGAAACCGAT
TTCCTGGCGCCCATCGATGTCGGACGGCTGAACCTGAAGCTGTTGAAGACCGGCGACGATCTGGCTGGTT
ATGAACTGCTCGGGCTTGCCCGCGTGGTCGAGGTGCGCTCCGACAAGGCTGTTCTCCTCGACCCGGATTT
CATTCCAGCCAGCTTGAACTGCACGGCGTCCTCAAGACTGCATGAATTGATGACCGAATTGCTGGGCATC
GTCCGGCACCGGGCGGAAGCGATTGCCGAGCGGATCGGCGATCCGACCATTCGCGGCACCGCGGAAGTTG
GTGATTATTTCCTGTTGCAGATCCTCAACCGCGCCGATCCGCTGTTGAAACATGCATTGTCCAACGCCAC
ACGCCTGCATCCCATACAGTTTTACGAGCAATGCATTCAGCTAGCCGGCGAGCTTGCAACGTTCACCATG
GAGAGCAAGCGGGCGACGGATTTTCCGGCCTATCGCCATGACGATCTGAAGGCGACGTTTGGCGCTGTCT
TCGAGGATTTGCGCACCTCGCTGTCCTCGGTGCTGGCGCAATCGGCTGTCGCTATCGAGCTGGTGGAACG
CCGCCACGGCGTGCGGGTCGGCACGATCAACGACCGCAGCCTGCTGCGCGATGCTGGTTTCGTGCTGGCA
GTGCGGGCGGACATGTCGGCGGAAGACGTGCGCCGCACCCTACCCGCTCGTATCAAGGTCGGGCCGGTGG
AGCGGATCGCCGAACTGGTCAATGTCGCGCTGCCGGGCATTCCGGTGCGCCCGTTGCCAGTTCTGCCACG
CCAGCTGCCTTACCGGGCCGGAACCATCTATTTCGAGCTGGATACCAAGACGCCGCTCTGGAAACAGCTT
GAAACATCCGGGGCGATTGCCCTGCACCTGGCAGGCGACTTCCCTGGTCTTGAACTCGAAATGTGGGCCT
TGAGAGAATGA