SecReT6
Protein ID: 222106981
SecReT6 ID329
T6SS typei5
Gene symbolimpI
Locus tagAvi_6044
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1062701..1063960 [-]
Productforkhead-type phosphopeptide-binding protein
NoteFha
UniProt IDB9K2F8
KEGG IDavi:Avi_6044
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.70E-14, Aligned region: 26..90
Protein Sequence: 419 a.a.     [Download]
>gi|222106981|ref|YP_002547772.1| forkhead-type phosphopeptide-binding protein [Agrobacterium vitis S4]
MKLELRPEKPVTKGQTTWTLDYGRRTIGRAPACDWQVTDNECRVSKLHCTISRDRDGYVLSDQSANGTLV
DGKLLLEGDTIRLKHGASIDVRGYRFTVSITGEATPEAVDPDPTMPVSSETLTISSILADIAPNGTTARG
LLGDRQVEEPWKQPRPSERGMSGGATQSDRRADKEKSFTRHVDIGWSGPPQTDGMKPVLPDNWFDEDAGG
SAMEHLAAPKTFVTIAPPVRRSPQELPPPQEERSKPQDEFDAVFADPEDQEPDARQSPSASDLQAERMMA
ALSRAQEALAESIAAFDLPGDAVPSLSSSNDTDLAARLEAFAGQQEAFAAILQTMMQAAGRSLDPRLLEA
KVDANSPVRLPFLAERDYWAAYRQLFQAEGRILSFRDFMRRAAMGEQAEEPAVPVQADRVMGVETTDET
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1063960-1062701 Agrobacterium vitis S4 chromosome 2, complete genome
ATGAAGCTGGAACTTCGCCCCGAAAAACCAGTTACCAAGGGCCAGACCACATGGACACTGGACTATGGTC
GCCGGACCATTGGCCGCGCCCCTGCCTGCGATTGGCAAGTGACGGACAATGAATGTCGCGTCTCGAAACT
GCATTGCACCATCAGCCGGGACCGGGACGGTTACGTGCTGAGCGACCAGAGCGCCAATGGCACATTGGTC
GATGGCAAGCTGCTGCTGGAAGGCGATACGATCCGGCTCAAGCACGGCGCCAGCATCGATGTGCGCGGCT
ACCGGTTTACCGTTTCAATTACCGGTGAGGCGACGCCTGAGGCGGTCGATCCCGATCCAACCATGCCGGT
TAGCAGTGAGACGCTGACGATTTCCTCGATCCTTGCCGATATCGCCCCGAATGGCACCACCGCCCGCGGC
CTTCTGGGAGACCGGCAGGTGGAGGAACCGTGGAAGCAACCCCGGCCATCAGAGCGAGGCATGTCTGGAG
GGGCCACACAATCTGACCGTCGGGCGGACAAGGAAAAGAGCTTTACCCGTCATGTCGATATCGGCTGGAG
CGGTCCGCCGCAGACCGATGGCATGAAACCCGTCTTGCCGGACAATTGGTTCGATGAGGATGCCGGTGGA
AGCGCCATGGAACATCTGGCCGCGCCGAAAACCTTCGTGACCATCGCGCCCCCCGTTCGCCGTTCGCCGC
AGGAATTGCCCCCTCCGCAAGAGGAGCGGTCAAAACCGCAGGACGAATTTGACGCGGTGTTCGCCGATCC
TGAGGATCAGGAGCCGGATGCGCGACAGAGCCCATCGGCTTCAGATCTGCAAGCGGAGCGGATGATGGCG
GCGCTCTCCCGCGCCCAAGAGGCTCTGGCCGAAAGCATCGCGGCCTTCGACCTGCCAGGTGATGCCGTGC
CTTCCCTGTCGAGCAGTAACGACACCGATCTTGCCGCCCGGCTTGAAGCCTTTGCCGGACAGCAGGAGGC
CTTCGCGGCGATTTTGCAAACCATGATGCAGGCGGCAGGCCGGTCGCTGGACCCACGCCTGCTGGAGGCC
AAGGTAGACGCAAACTCGCCGGTGCGGCTGCCTTTCCTTGCCGAGCGCGACTACTGGGCGGCCTATCGGC
AATTGTTTCAGGCCGAGGGCCGTATTCTTTCATTCAGGGATTTCATGCGTCGCGCCGCCATGGGCGAGCA
GGCCGAAGAGCCAGCCGTACCGGTTCAAGCCGACAGAGTAATGGGGGTAGAAACAACCGATGAGACATGA