SecReT6
Protein ID: 222106982
SecReT6 ID329
T6SS typei5
Gene symbolimpH
Locus tagAvi_6045
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1063957..1064967 [-]
Producthypothetical protein
NoteTssG
UniProt IDB9K2F9
KEGG IDavi:Avi_6045
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.40E-65, Aligned region: 34..310
Protein Sequence: 336 a.a.     [Download]
>gi|222106982|ref|YP_002547773.1| hypothetical protein Avi_6045 [Agrobacterium vitis S4]
MNIQIKPNEDKLARLLEQDPGHFESTTAFRVAQHLSSGTELEVGAHSGIQPAPLAVSGFRRKLQGNVVKS
AFAPLVGPLGALPPEYNELLLREERRRSRALISFLNLFAIRFSELFVAACEKYRLARRLRWSATKEQNTF
RKVLLSLTGFGTAGLVEKAGINEDVILRFSGFFADRTRNVASLRAMLEEFTGMAVAIEQFRPRWVSIPSA
ELSQMGKGSGPRLGVNAMAGASVMDRSGALRLVIGPVGYDDYISLSPGKPRLAEIFALTRLFIGNGFDID
AQVVLKKEDIPFCQMGSATMPARLGWNSWARLAPASTDSRDAVVTEYQAMPQGGLA
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1064967-1063957 Agrobacterium vitis S4 chromosome 2, complete genome
ATGAATATCCAGATCAAACCCAATGAGGATAAGCTGGCCCGCCTGCTGGAGCAGGACCCCGGCCATTTTG
AATCGACCACGGCATTTCGGGTGGCACAGCACCTGTCATCGGGAACGGAGCTGGAGGTCGGGGCCCATTC
CGGCATTCAGCCAGCCCCTCTTGCCGTCAGCGGTTTTCGCCGCAAGTTGCAGGGCAATGTCGTCAAATCG
GCTTTTGCGCCGCTGGTCGGGCCGCTTGGCGCGCTGCCGCCGGAATATAACGAATTGCTGCTGCGCGAAG
AGCGTCGGCGTTCCCGCGCCTTGATCAGCTTTCTCAACCTGTTTGCCATCCGGTTTTCGGAACTGTTTGT
GGCGGCCTGCGAGAAATACCGGCTGGCACGGCGGCTGCGCTGGAGTGCCACCAAGGAACAAAACACCTTC
CGCAAGGTGTTGCTATCGCTGACCGGCTTCGGCACCGCCGGACTGGTGGAAAAGGCAGGCATCAATGAAG
ATGTGATCCTGCGGTTTTCCGGATTTTTTGCCGACCGTACCCGCAATGTCGCCAGTCTTCGAGCCATGCT
GGAGGAGTTTACCGGCATGGCGGTGGCGATTGAGCAGTTTCGTCCGCGCTGGGTCTCCATTCCGTCGGCA
GAGTTGAGCCAGATGGGCAAGGGGTCCGGCCCAAGACTCGGCGTCAACGCCATGGCGGGTGCATCCGTCA
TGGACCGGAGCGGAGCACTGAGGCTGGTCATCGGTCCGGTTGGCTATGACGATTATATCAGCCTATCGCC
TGGCAAGCCGCGTCTTGCGGAAATCTTCGCCCTCACCCGCCTGTTTATCGGCAACGGCTTTGATATCGAT
GCCCAGGTCGTCCTGAAAAAAGAAGACATTCCGTTTTGTCAGATGGGGTCTGCGACCATGCCTGCCCGGC
TCGGCTGGAACAGCTGGGCGCGGCTGGCCCCAGCAAGCACTGACAGCCGCGATGCCGTGGTTACCGAATA
TCAGGCCATGCCGCAGGGAGGTCTGGCATGA