SecReT6
Protein ID: 222106983
SecReT6 ID329
T6SS typei5
Gene symbolimpG
Locus tagAvi_6046
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1064976..1066757 [-]
Producthypothetical protein
NoteTssF
UniProt IDB9K2G0
KEGG IDavi:Avi_6046
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-182, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|222106983|ref|YP_002547774.1| hypothetical protein Avi_6046 [Agrobacterium vitis S4]
MAETFLERYNDELFALRRRAEKFARAFPKIAGRLRLSGDVADDPHVERIIQSFAYSAARVRQKLDDEFPE
LTDSLLETLYPHYLAPVPPMSIVQFAPGATLAGMQLLPRHTDIVTEPVGGDPCQFRTTQDVEIVPMTVSN
ASLTGLPLDAPAAPFAGAAGVLRLSLRSTAPKQDSMAGLGVKRLTFFIASAWAQAAALFELLANHCIGMA
LARHSEDRNAVFLPAENLRPLGFAPEQAMLPTAPGSFAGYRLLTEFFTLPQKFLFLEVSGMDRWQGDDVE
LYIYLDSSDARLERMISASDIVLNATPVINLFRQSSEPLTLDGSRTEYSLLPDSRRQTTREIYMVEQVRL
SAASGEEQDARPFFGSSQRGANSSVFWQAVRRFDEDDGSSDTQIAFVDRNRGPLEPTGLTASVDTLCLNR
DLASQLPFGGGHPHLQLVKRSESVAEIKALLPPTPAIRIHEKLARQWRLVSHLLLNHLSLFDNDGSALKD
ILSLYALRDAPETRQLVEAISRVEAKHALARLGPAMVPGTDVTIEFDPAMIDRAAAFIFGSIIDHFCGLY
TSVNSFTRLTLTMRGQSEPIVRWPARAAERPLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1066757-1064976 Agrobacterium vitis S4 chromosome 2, complete genome
ATGGCTGAGACCTTTCTGGAACGCTATAATGACGAATTGTTCGCGCTGCGCAGGCGTGCGGAAAAGTTCG
CCCGCGCCTTCCCGAAAATCGCCGGTCGGTTGCGTCTGTCGGGTGATGTGGCCGACGATCCGCATGTAGA
GCGGATCATCCAGAGTTTCGCCTATTCCGCCGCCCGCGTTCGCCAGAAACTGGATGATGAATTTCCGGAA
CTGACCGACAGCCTGCTGGAAACGCTTTATCCCCATTATCTGGCGCCGGTGCCGCCGATGAGCATCGTGC
AATTTGCGCCAGGCGCAACGCTGGCTGGTATGCAATTGCTGCCGCGCCATACCGACATCGTCACCGAGCC
GGTCGGCGGCGATCCCTGCCAGTTCCGCACCACGCAGGATGTGGAAATTGTCCCGATGACGGTCAGCAAT
GCCAGCCTGACCGGCTTGCCACTCGATGCGCCAGCGGCACCCTTTGCAGGTGCAGCAGGCGTGTTGCGTC
TGTCCCTGCGCTCTACGGCCCCCAAGCAGGACAGCATGGCCGGGCTTGGCGTCAAGCGCCTGACTTTTTT
CATTGCCTCCGCATGGGCGCAGGCCGCCGCCCTGTTCGAGCTTCTGGCCAATCATTGCATCGGCATGGCG
CTGGCACGCCATTCGGAGGATCGCAATGCGGTCTTTCTGCCAGCGGAAAACCTGCGTCCACTGGGGTTTG
CGCCGGAGCAGGCGATGCTTCCCACGGCACCGGGCAGTTTTGCCGGATACCGGCTGCTGACCGAGTTTTT
CACGTTGCCGCAAAAATTTCTGTTCCTGGAAGTATCCGGCATGGATCGCTGGCAGGGCGATGATGTCGAG
CTTTACATCTATCTGGACAGCAGTGATGCGCGACTGGAGCGGATGATTTCCGCCAGCGACATCGTCCTCA
ATGCCACCCCGGTCATCAATTTGTTCCGGCAAAGCTCGGAACCGCTGACATTGGATGGCAGCCGCACGGA
ATATTCGCTCCTGCCCGACAGCCGCCGCCAAACGACCCGGGAAATCTACATGGTCGAACAGGTCCGGCTT
TCGGCGGCGTCCGGCGAAGAACAGGATGCCCGGCCATTTTTCGGGAGCAGCCAGCGGGGCGCCAATAGCA
GTGTGTTCTGGCAGGCGGTTCGCCGGTTCGATGAGGATGACGGATCATCGGACACCCAGATCGCCTTCGT
TGATCGCAATCGCGGTCCGCTTGAGCCGACCGGACTGACGGCCAGCGTCGATACCCTATGCCTGAACAGA
GACCTTGCCAGCCAATTGCCTTTCGGCGGCGGTCACCCGCACCTTCAATTGGTCAAGCGCAGTGAAAGCG
TGGCCGAGATCAAGGCGCTTTTACCGCCAACGCCCGCCATTCGTATCCATGAAAAACTGGCGCGCCAGTG
GCGGCTGGTCTCCCATCTGCTGCTCAATCATCTGTCACTGTTCGACAATGACGGTTCGGCACTGAAGGAT
ATTCTTTCGCTCTATGCATTGCGCGATGCGCCGGAAACGCGACAGCTTGTCGAGGCCATCAGCCGCGTCG
AGGCAAAACATGCACTCGCCCGGCTTGGCCCCGCCATGGTGCCAGGCACCGATGTCACGATCGAATTCGA
CCCGGCTATGATCGACCGGGCGGCCGCTTTCATCTTCGGCAGCATCATTGATCATTTCTGCGGGCTCTAT
ACCTCGGTCAACAGTTTCACCCGGCTGACCCTCACCATGCGCGGCCAGTCCGAGCCAATTGTCCGCTGGC
CCGCCCGGGCCGCCGAGCGGCCTTTGCTGTAG