SecReT6
Protein ID: 222106984
SecReT6 ID329
T6SS typei5
Gene symbolimpF
Locus tagAvi_6047
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1066750..1067259 [-]
Producthypothetical protein
NoteTssE
UniProt IDB9K2G1
KEGG IDavi:Avi_6047
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-16, Aligned region: 43..142
Protein Sequence: 169 a.a.     [Download]
>gi|222106984|ref|YP_002547775.1| hypothetical protein Avi_6047 [Agrobacterium vitis S4]
MVDPLQRFRASERVLNRSVLDRLLDDTPDMDSDPQTSVSEQVREMREVIRRDLEALLNTRRCPQAPPDGL
SELQDALVSYGVDGILSANLSTDESKLRLARLVERRIALFETRLADVKVTILKGNTEGDRALRMRINGTF
RLYDGMPPVSFESRIDPSTQAFRIEASNG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1067259-1066750 Agrobacterium vitis S4 chromosome 2, complete genome
ATGGTTGATCCATTACAACGGTTTCGCGCCTCTGAACGGGTATTGAACCGATCCGTCCTGGACCGGCTGC
TGGACGATACGCCTGATATGGACAGTGATCCGCAAACCAGCGTCAGCGAACAGGTGCGGGAGATGCGCGA
AGTGATCCGCCGCGACCTGGAAGCGCTGTTGAACACCCGCCGCTGCCCGCAAGCACCACCGGATGGCCTT
AGCGAGTTGCAGGACGCGTTGGTCTCCTATGGCGTCGATGGTATTCTTTCGGCCAATCTTTCGACGGACG
AATCCAAACTTCGGCTGGCAAGACTGGTGGAACGGCGCATTGCGCTGTTTGAGACCCGCCTCGCCGACGT
CAAGGTCACGATCCTCAAAGGCAATACAGAGGGCGACCGCGCCTTGCGGATGCGCATCAACGGTACGTTC
CGTCTTTATGACGGGATGCCGCCGGTCAGTTTCGAATCCCGCATCGACCCTTCCACCCAGGCTTTCCGCA
TCGAGGCGTCGAATGGCTGA