SecReT6
Protein ID: 222106985
SecReT6 ID329
T6SS typei5
Gene symbolimpE
Locus tagAvi_6048
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1067252..1068079 [-]
Producthypothetical protein
NoteTagJ
UniProt IDB9K2G2
KEGG IDavi:Avi_6048
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.40E-34, Aligned region: 142..263
Protein Sequence: 275 a.a.     [Download]
>gi|222106985|ref|YP_002547776.1| hypothetical protein Avi_6048 [Agrobacterium vitis S4]
MSTASRRIASLLDDADLAQAMDAVKAELKTAASDHDLRHLYIDLLILAGDYEKADSQCELAVRFQPQDAV
GFSMLRQQIRGMAARKAWFETGALPDFPGGLTASDQIALKLNLALKEGAASEAVALLAELEASRGTVPML
WNGGAVADIRDLDDRIPHALEVLTTGGAYLWVDFSRIASVTPQPIRRPRDTAFRPAELTLESGAEATVLL
PAIYYGADSSPALQLGHETEWMDAVDGIVTGLGQRCLLAGDELVSFHDLESLQSDATGERQAAHG
 
Nucleotide Sequence: 828 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1068079-1067252 Agrobacterium vitis S4 chromosome 2, complete genome
ATGAGTACCGCCTCCCGCCGCATTGCCAGCCTGCTCGATGATGCAGATCTTGCCCAGGCCATGGATGCCG
TCAAAGCCGAATTGAAAACGGCGGCCAGCGATCATGACCTGCGCCATCTCTATATCGACCTGCTGATTCT
GGCTGGCGATTATGAAAAAGCCGACAGCCAATGCGAATTGGCTGTCCGCTTCCAGCCGCAGGATGCCGTC
GGTTTTTCGATGCTGCGCCAGCAGATCCGTGGGATGGCAGCCCGCAAAGCCTGGTTTGAAACCGGTGCCC
TGCCGGATTTTCCCGGTGGCCTCACCGCCAGCGACCAGATTGCGCTAAAGCTCAACCTGGCCCTGAAGGA
AGGAGCGGCAAGCGAGGCCGTGGCCCTGCTTGCCGAACTGGAAGCGAGCCGTGGCACTGTGCCGATGCTA
TGGAACGGCGGCGCCGTTGCCGATATCCGCGATCTCGACGACCGTATCCCTCATGCGCTTGAAGTGCTGA
CCACCGGCGGCGCCTATCTCTGGGTCGATTTTTCAAGGATCGCGTCTGTTACGCCTCAACCGATACGCCG
CCCCCGGGACACGGCCTTCCGCCCGGCGGAACTGACACTGGAAAGCGGCGCCGAGGCGACCGTGCTTCTT
CCCGCCATTTATTATGGCGCCGATTCCAGCCCTGCCCTGCAACTCGGCCATGAGACCGAGTGGATGGATG
CGGTGGACGGGATCGTCACCGGTCTTGGCCAGCGATGCCTGCTGGCGGGCGACGAACTGGTGTCTTTCCA
CGATCTTGAAAGCTTGCAATCGGATGCGACCGGCGAAAGGCAGGCTGCCCATGGTTGA