SecReT6
Protein ID: 222106986
SecReT6 ID329
T6SS typei5
Gene symbolimpD
Locus tagAvi_6049
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1068076..1069443 [-]
Producthypothetical protein
NoteTssC
UniProt IDB9K2G3
KEGG IDavi:Avi_6049
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.40E-148, Aligned region: 4..435
Protein Sequence: 455 a.a.     [Download]
>gi|222106986|ref|YP_002547777.1| hypothetical protein Avi_6049 [Agrobacterium vitis S4]
MLADRLIAEIDAVLNRQVNAILHHPDFQAMEARWLGLDLLVREAGRSAEVKIKLISASWKELARSMERAT
DFDQSHLFELVYNREFGMPGGEPFGLLVGDYDLSPATIDGSDTVSTLARLSTVAAAAFCPFIAGASPQAI
GLETFRELNRVSDFSWLQQDKMRLRWNSLRGNDDTRFLGLVAPRVLMRPPHKPFWRKRNDGFPFREHLSE
SGETLLWGNSAFAFAAIILRTFIDSGWFADMRGVTQDEIDGGMLAPWQLPGLDIGVESEGLSAQPPVEVK
LTRSQELQLSDLGIVPVATTYLSSSAIFNANQSLHAPGHYSSETARQNARLAAMLQYVLCASRFSHYLKV
IMRDNIGQLSTANVIQRRLEDWLSGYTLGNDDADVSLRSRYPLRSAGIHVTEIPGKPGAFSCTVRLQPHF
QLDDISTSFHLVAETSGAAAMGATAGQTEPKRIVA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1069443-1068076 Agrobacterium vitis S4 chromosome 2, complete genome
ATGCTGGCGGATCGGTTGATCGCGGAAATCGACGCGGTTTTGAACCGGCAGGTGAATGCAATTCTACATC
ATCCCGACTTCCAGGCGATGGAAGCGCGGTGGCTTGGTCTTGACTTGCTAGTCCGCGAAGCCGGACGCAG
CGCCGAGGTGAAAATCAAGCTGATCAGCGCCAGTTGGAAAGAATTGGCGCGCAGCATGGAACGCGCCACC
GATTTCGACCAGAGCCACCTGTTCGAACTGGTCTATAACAGAGAATTCGGCATGCCGGGCGGTGAACCGT
TCGGACTTCTGGTCGGCGATTACGATCTCTCTCCCGCCACCATCGATGGTAGCGATACAGTCAGTACGCT
TGCACGACTTTCAACGGTAGCCGCAGCGGCCTTTTGTCCCTTCATCGCCGGTGCATCGCCGCAGGCCATC
GGGCTTGAAACCTTCCGCGAACTGAACCGGGTTTCCGATTTTTCCTGGCTGCAACAGGACAAGATGCGGC
TGCGCTGGAATAGCTTGCGCGGCAATGACGATACTCGTTTCCTGGGCCTGGTTGCACCGCGCGTGCTGAT
GCGCCCGCCGCACAAACCATTCTGGCGCAAGCGCAATGACGGTTTTCCGTTTCGTGAACATCTCTCGGAA
AGCGGAGAGACTTTGCTCTGGGGAAACAGTGCCTTCGCCTTTGCGGCGATTATTCTGCGCACCTTTATCG
ATTCCGGCTGGTTTGCCGACATGCGCGGCGTGACCCAGGACGAGATCGATGGCGGCATGCTGGCGCCCTG
GCAATTGCCGGGCCTTGATATCGGTGTGGAAAGCGAGGGCCTGTCCGCCCAGCCGCCCGTCGAGGTCAAA
CTGACACGCTCACAAGAATTGCAACTGTCCGATCTCGGCATCGTCCCCGTTGCCACGACCTATCTTTCAT
CATCCGCGATTTTCAACGCCAACCAGTCGCTGCACGCGCCGGGCCATTATTCCAGCGAAACCGCCCGGCA
AAATGCCCGGCTGGCGGCCATGCTGCAATATGTGCTCTGCGCGTCACGCTTCTCGCATTACCTGAAGGTG
ATCATGCGCGACAATATTGGCCAGCTCAGCACCGCCAATGTCATTCAGCGACGGCTGGAAGACTGGCTGT
CAGGCTACACGCTGGGCAATGACGATGCGGATGTGTCGCTCAGAAGCCGTTATCCGCTGCGTTCAGCGGG
CATCCACGTCACGGAAATTCCTGGAAAACCCGGCGCCTTTTCCTGCACGGTCAGATTGCAGCCGCATTTC
CAGCTCGATGATATCTCCACCAGTTTTCATCTCGTCGCCGAGACCTCGGGCGCTGCCGCCATGGGCGCTA
CCGCCGGGCAGACGGAACCGAAAAGGATAGTTGCATGA