SecReT6
Protein ID: 222106987
SecReT6 ID329
T6SS typei5
Gene symbolimpC
Locus tagAvi_6050
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1069546..1071027 [-]
Producthypothetical protein
NoteTssC
UniProt IDB9K2G4
KEGG IDavi:Avi_6050
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.40E-192, Aligned region: 64..490
Protein Sequence: 493 a.a.     [Download]
>gi|222106987|ref|YP_002547778.1| hypothetical protein Avi_6050 [Agrobacterium vitis S4]
MSAESVLKPNEPTAATEEQGLLSKVVAATRQTEPDRARNLLSTLTDQALKGTVKYDRNLTVTLNNAIAEL
DKVISTQLAAIMQSPEFTKLEGSWRGLNYLVKNSETSVNLKIRVLNASKRELSKDLAKAVEFDQSRLFKS
IYEDEFGTPGGEPMGAVVGDYEFDNSFEDVQLLQGVSSIAAAAFAPFVSAASPRMFGFDDFRELSRPRDL
EKIFETVEYAKWRSFRESDDSRFVTLALPRVLARMPYSPKTSQIDEFGFDETLGEASGELHHDSYCWMNA
AYVMGTRLTEAFAKNGWCTAIRGAENGGKVENLPMHVFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLP
LCHYKNTDYAVFFGAQTAHKPKLYDKPEATANAAVSARLPYMMATSRFAHYLKVMGRDKIGSFMEADDCE
VWLNRWISNYVNANDDAGEDSRAKYPLRDAKVTVQEIPGKPGSYNAVAWLRPWLQMEELTTSLRMVARIP
SKN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1071027-1069546 Agrobacterium vitis S4 chromosome 2, complete genome
ATGAGCGCTGAAAGCGTTTTGAAGCCGAATGAACCGACCGCCGCCACCGAGGAACAGGGGCTGTTGTCGA
AAGTCGTTGCCGCCACCCGTCAGACGGAGCCGGACCGCGCCCGCAACCTTTTGAGCACCCTGACGGATCA
GGCCCTGAAAGGTACTGTAAAATACGACCGCAACCTGACGGTCACCTTGAACAATGCCATTGCCGAGCTG
GACAAGGTGATTTCCACCCAGCTCGCCGCCATTATGCAATCGCCGGAATTTACCAAGCTGGAAGGCAGCT
GGCGAGGGCTGAACTATCTGGTCAAGAATTCTGAAACCAGCGTCAACCTGAAAATCCGGGTGCTGAACGC
CTCCAAGCGCGAACTGTCGAAAGACCTGGCCAAAGCGGTCGAATTCGACCAGTCGCGGCTGTTCAAGTCG
ATTTATGAAGACGAATTCGGCACGCCTGGCGGTGAACCGATGGGTGCTGTCGTCGGCGATTACGAATTCG
ATAATTCTTTCGAGGACGTCCAATTGCTTCAGGGCGTGTCCTCGATTGCCGCCGCAGCCTTCGCACCGTT
TGTCTCGGCAGCAAGCCCGCGCATGTTTGGCTTTGACGATTTCCGGGAATTGTCGCGGCCCCGCGATCTC
GAAAAGATCTTCGAGACCGTGGAATATGCGAAATGGCGCAGCTTCCGCGAAAGCGACGATTCGCGTTTCG
TCACGCTGGCCCTTCCCCGGGTGTTGGCGCGTATGCCCTATAGCCCGAAAACCAGCCAGATCGACGAGTT
CGGTTTTGATGAAACCCTGGGCGAGGCAAGCGGCGAGCTGCATCACGACAGCTATTGCTGGATGAATGCC
GCCTACGTCATGGGGACACGCCTCACCGAAGCCTTTGCGAAGAACGGCTGGTGCACAGCCATCCGTGGCG
CAGAAAACGGCGGCAAGGTGGAAAACCTGCCCATGCATGTGTTCTCAAGCGATGATGGCGACCTCGACCT
GAAATGCCCGACAGAAGTCGGCATTACCGACCGTCGCGACGCCGAGTTGGGCAAGCTGGGCTTCCTTCCG
CTCTGCCACTACAAGAACACCGATTACGCCGTGTTCTTCGGCGCGCAAACCGCCCATAAGCCGAAGCTCT
ACGACAAGCCCGAAGCGACAGCCAATGCCGCCGTTTCCGCCCGCCTGCCCTATATGATGGCGACCTCACG
GTTCGCCCATTATCTGAAGGTCATGGGCCGCGACAAGATCGGCTCCTTCATGGAAGCAGACGATTGCGAA
GTCTGGCTCAATCGCTGGATCTCCAATTACGTCAATGCGAATGACGATGCTGGAGAAGATTCGCGCGCAA
AGTATCCGCTGCGCGATGCCAAGGTGACGGTACAGGAAATCCCTGGCAAACCGGGCTCCTACAATGCGGT
CGCCTGGCTGCGTCCATGGTTGCAGATGGAAGAGCTGACAACTTCGCTGCGCATGGTTGCCCGTATTCCA
TCGAAAAACTGA