SecReT6
Protein ID: 222106988
SecReT6 ID329
T6SS typei5
Gene symbolimpB
Locus tagAvi_6051
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1071100..1071615 [-]
Producthypothetical protein
NoteTssB
UniProt IDB9K2G5
KEGG IDavi:Avi_6051
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-58, Aligned region: 8..162
Protein Sequence: 171 a.a.     [Download]
>gi|222106988|ref|YP_002547779.1| hypothetical protein Avi_6051 [Agrobacterium vitis S4]
MASVHEKLERVRKPRVHIKYEVETEGAMVIKELPFVVGVLGDFSGNPTQPLKPFNERKFVQIDRDNFDDV
MRRMTPGLNIQVKNTIDNDGTDIGVNLKFESMDDFLPGSVVQQVPALKALLDARNELRDLLSKADRSEDL
ERLLEDILQNRGDLSKLVAELKDRPDSNGQS
 
Nucleotide Sequence: 516 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1071615-1071100 Agrobacterium vitis S4 chromosome 2, complete genome
ATGGCAAGTGTGCATGAAAAGCTAGAGCGGGTTCGCAAGCCCAGGGTCCACATCAAATACGAGGTGGAAA
CCGAAGGTGCGATGGTGATCAAGGAACTGCCTTTCGTGGTGGGTGTGCTCGGCGATTTCTCCGGCAACCC
GACCCAGCCGCTGAAGCCGTTCAACGAGCGGAAATTCGTCCAGATCGACCGGGACAATTTCGACGATGTG
ATGCGCCGCATGACGCCCGGCCTGAATATCCAGGTGAAGAATACCATTGACAATGACGGCACCGACATCG
GCGTCAATCTGAAGTTCGAAAGCATGGACGATTTCCTGCCGGGGTCGGTAGTGCAGCAGGTGCCAGCGCT
GAAAGCGCTTCTGGATGCCCGCAATGAATTGCGCGACCTACTCAGCAAGGCGGACCGTTCCGAAGATCTC
GAACGGCTTCTCGAAGACATTCTGCAAAACCGTGGTGATCTTTCAAAGCTCGTCGCCGAGCTGAAAGACC
GGCCCGACAGCAACGGCCAGAGCTGA