SecReT6
Protein ID: 222106989
SecReT6 ID329
T6SS typei5
Gene symbolimpA
Locus tagAvi_6052
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1071691..1072767 [-]
Producthypothetical protein
NoteTssA
UniProt IDB9K2G6
KEGG IDavi:Avi_6052
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 59..116
Protein Sequence: 358 a.a.     [Download]
>gi|222106989|ref|YP_002547780.1| hypothetical protein Avi_6052 [Agrobacterium vitis S4]
MIDNELATALVENGPCGINIRVDANYREVYYRIKDARNQARTEERSTTPGEVIKVSQSWNLVSNLGLQIT
SSVSKDLEVLAWLAESRLRLEGFPGLSEVYEATASLIERYSDELHSIDDEDIEEKLAPFAGLNGFGAEGT
LIQPLRLSSLLPLGKFGEFTLWDYQLAQRSDETGLRDSLHQAAAEAGIAALSAHLAEVNTCLAAFNGFNA
LVTQRYGQFAPPASNIRNVLEEIIAAIRSLGGRDDATLPANQNATPSGEDGQTTQQNAAAGAIQPAARPA
EGPEGIASREDAFDLLMNVARYFRRTEPHSPISLSIETLVRRGRMDFSELLTELLPEAQTRNAILIAAGI
KPAKESGN
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1072767-1071691 Agrobacterium vitis S4 chromosome 2, complete genome
TTGATCGACAATGAATTGGCTACAGCATTAGTAGAAAACGGACCTTGCGGAATAAATATTCGCGTGGATG
CCAATTATCGTGAGGTATACTACAGAATTAAGGACGCAAGGAACCAAGCAAGGACGGAAGAAAGATCTAC
GACACCTGGAGAGGTTATCAAAGTTTCCCAAAGTTGGAACCTGGTGAGCAATCTTGGATTGCAAATTACT
TCTTCCGTCAGCAAAGATCTCGAAGTATTGGCTTGGCTTGCAGAATCCCGTTTGCGACTTGAAGGGTTTC
CCGGCCTGAGTGAAGTTTATGAAGCGACGGCGTCGCTTATAGAACGATATAGCGACGAGCTTCATTCGAT
TGATGATGAAGATATCGAGGAAAAGCTGGCACCCTTTGCCGGATTGAATGGTTTTGGCGCCGAGGGAACA
TTGATTCAGCCCTTACGCCTGTCTTCGCTTTTGCCGCTTGGGAAATTCGGGGAATTCACGCTTTGGGACT
ATCAACTTGCCCAGCGCAGTGATGAAACGGGTTTGCGCGATAGCCTGCATCAGGCCGCAGCCGAGGCCGG
AATAGCTGCTCTCTCTGCTCATCTGGCCGAGGTCAACACATGCCTCGCCGCCTTCAATGGCTTCAATGCG
CTCGTTACCCAGCGCTACGGACAGTTTGCCCCACCGGCATCCAATATCCGCAACGTGCTTGAGGAAATCA
TTGCGGCGATTCGCAGTCTTGGCGGGCGCGACGACGCGACATTGCCTGCCAATCAGAATGCCACCCCTTC
AGGTGAAGATGGACAGACGACCCAACAGAATGCTGCGGCCGGCGCAATCCAGCCCGCTGCCCGCCCAGCC
GAGGGGCCCGAAGGCATTGCTTCGCGTGAAGACGCCTTCGATCTCCTGATGAATGTCGCCCGCTATTTCC
GCCGCACGGAACCGCATTCGCCGATTTCGCTGTCGATTGAAACCCTGGTGCGGCGAGGACGCATGGATTT
TTCCGAATTGCTGACGGAGTTGCTGCCGGAAGCACAGACCAGAAATGCCATTCTCATTGCTGCCGGCATC
AAACCGGCCAAGGAGAGCGGAAACTAA