SecReT6
Protein ID: 222106990
SecReT6 ID329
T6SS typei5
Gene symbolclpB
Locus tagAvi_6053
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1072987..1075698 [+]
ProductATP-dependent Clp protease ATP-binding subunit
NoteTssH
UniProt IDB9K2G7
KEGG IDavi:Avi_6053
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.60E-40, Aligned region: 213..290
AAA_2 [PF07724], Evalue: 4.60E-40, Aligned region: 605..768
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 214..326
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 453..488
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 610..731
AAA_5 [PF07728], Evalue: 6.40E-14, Aligned region: 214..234
AAA_5 [PF07728], Evalue: 6.40E-14, Aligned region: 609..730
ClpB_D2-small [PF10431], Evalue: 7.20E-13, Aligned region: 777..847
AAA_16 [PF13191], Evalue: 6.10E-10, Aligned region: 191..235
AAA_16 [PF13191], Evalue: 6.10E-10, Aligned region: 258..292
AAA_16 [PF13191], Evalue: 6.10E-10, Aligned region: 448..448
AAA_16 [PF13191], Evalue: 6.10E-10, Aligned region: 579..624
AAA_16 [PF13191], Evalue: 6.10E-10, Aligned region: 674..702
Sigma54_activat [PF00158], Evalue: 1.30E-08, Aligned region: 209..231
Sigma54_activat [PF00158], Evalue: 1.30E-08, Aligned region: 604..717
AAA_22 [PF13401], Evalue: 6.60E-08, Aligned region: 214..301
AAA_22 [PF13401], Evalue: 6.60E-08, Aligned region: 331..374
AAA_22 [PF13401], Evalue: 6.60E-08, Aligned region: 608..628
AAA_22 [PF13401], Evalue: 6.60E-08, Aligned region: 670..690
Clp_N [PF02861], Evalue: 3.50E-07, Aligned region: 28..73
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 214..236
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 296..348
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 603..649
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 214..243
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 609..691
AAA_25 [PF13481], Evalue: 7.00E-05, Aligned region: 214..238
AAA_25 [PF13481], Evalue: 7.00E-05, Aligned region: 454..469
AAA_25 [PF13481], Evalue: 7.00E-05, Aligned region: 605..631
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 208..237
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 609..627
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 192..228
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 266..368
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 605..621
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 211..236
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 607..628
AAA_17 [PF13207], Evalue: 0.0012, Aligned region: 214..233
AAA_17 [PF13207], Evalue: 0.0012, Aligned region: 449..476
AAA_17 [PF13207], Evalue: 0.0012, Aligned region: 609..644
AAA_18 [PF13238], Evalue: 0.0022, Aligned region: 214..234
AAA_18 [PF13238], Evalue: 0.0022, Aligned region: 611..638
SRP54 [PF00448], Evalue: 0.0022, Aligned region: 214..233
SRP54 [PF00448], Evalue: 0.0022, Aligned region: 606..631
PhoH [PF02562], Evalue: 0.0029, Aligned region: 201..238
PhoH [PF02562], Evalue: 0.0029, Aligned region: 608..627
DUF2075 [PF09848], Evalue: 0.0085, Aligned region: 216..316
DUF2075 [PF09848], Evalue: 0.0085, Aligned region: 607..641
Protein Sequence: 903 a.a.     [Download]
>gi|222106990|ref|YP_002547781.1| ATP-dependent Clp protease ATP-binding subunit [Agrobacterium vitis S4]
MSHIDLNRLIESLEPNLRVALETAASTAAGRGHGQVDIAHLLAAVMDAASFQPVLEQLGLPIAALRREVS
DALDDTVVSGSGQLALSQNILTLGREAWICASLQSGRRAITLADIFAAMDDEPSLRALTRGRFPSLRMLD
RTALETLLQTDVVAETPKSSLSPASVREDEFLRLYTHDLTEDARAGRLDPVVGRDGELRQMIDILLRRRQ
NNPILVGEAGVGKTAVAEALALEIAAGRVPEKLQSVRLLMLDLTLLQAGAGVKGEFERRLTGVIEAVKRS
PEPIILFIDEAHGLIGAGGASGQGDAANILKPALARGEVRTIAATTWSEYKKYFEKDAALTRRFQPVHVR
EPDEETAIRMLRGIAETFMAHHGVKIRDEAIVAAVQLSARFLPARQLPDKAVSLIDTAAATVSLARQTVP
EQLLLLKSELAHLTVETDWLAREPENTDVQERRQAVTTEMERLAKEIDSLQARYDAEIAALAASDEAPAV
DSDKMASKDAPDVNVTPLITPLRTRGLVRRAASLAPTSAGEEKLVPHEVDRNVVAAVLARWTGIPLGKLL
ADQIESAKSLDMRLKEKVIGQDAALERIGDAMRAARAGLSDPRRPPAVFMLVGMSGTGKTETALTLADLM
YGGSQHLTTINMSEFKEEHKVSMLLGAPPGYVGYGEGGVLTEAVRRRPYGVLLLDEIDKAHPGVQDIFYQ
VFDKGMLRDGEGRDVDFRNTTIFMTANTGSELLASLALDPDTMPEGEALEALLMPELQKQFKPAFLGRTL
LLPFMPLGKEALSRIVDIQINRIRERIFSAYGTELALSEEARNALVGRAVASEIGARAIEIMIGRDLLPP
LSSFFLELVASGAKVTEALVTHDEKGFGVRAGAAGEKEEFADASGASVDKDAASEGVSRRMRQ
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|222106127|ref|NC_011988.1|:1072987-1075698 Agrobacterium vitis S4 chromosome 2, complete genome
ATGTCGCATATTGACCTCAATCGATTGATCGAATCGCTTGAGCCTAATTTGCGTGTCGCGCTTGAGACGG
CTGCATCCACAGCAGCCGGGCGCGGACACGGACAGGTTGATATTGCTCATCTGCTTGCCGCCGTCATGGA
TGCGGCGTCGTTTCAACCTGTGTTGGAACAATTGGGCTTGCCCATTGCAGCACTTCGCCGCGAAGTGAGC
GATGCGCTCGATGACACCGTGGTGTCCGGATCCGGTCAGCTCGCTTTATCCCAGAATATTCTGACTTTGG
GTCGTGAAGCCTGGATTTGTGCTTCGCTCCAGTCTGGAAGACGTGCGATTACGCTTGCCGATATATTTGC
GGCTATGGATGATGAGCCGTCGCTTCGGGCCTTGACCCGTGGTCGTTTCCCGTCGCTGAGGATGCTGGAC
CGAACAGCACTCGAAACACTTTTGCAGACAGACGTTGTCGCCGAGACGCCAAAATCGTCGCTGTCTCCGG
CCTCAGTCCGGGAAGACGAGTTCCTGCGACTTTACACTCATGACCTTACCGAGGATGCGCGGGCGGGCCG
GCTTGATCCTGTCGTCGGCCGTGATGGCGAACTTCGCCAGATGATCGACATTTTGTTGCGCCGGCGACAG
AATAACCCGATCCTGGTCGGTGAAGCGGGCGTTGGCAAGACAGCGGTGGCCGAAGCGCTGGCGCTGGAGA
TTGCCGCCGGACGCGTGCCGGAAAAATTGCAATCCGTACGGCTTCTGATGCTCGATCTGACTCTGTTGCA
GGCAGGCGCTGGCGTGAAGGGTGAGTTCGAACGGCGGTTGACCGGCGTTATCGAAGCGGTGAAACGTTCG
CCGGAACCTATCATCCTGTTTATCGATGAAGCGCATGGACTGATCGGTGCCGGTGGGGCAAGCGGGCAGG
GCGATGCCGCCAATATTCTCAAGCCCGCGCTAGCGCGGGGTGAAGTGCGGACAATCGCTGCCACGACTTG
GAGCGAGTACAAGAAGTATTTCGAAAAAGACGCAGCGCTTACCCGCCGCTTCCAACCCGTGCATGTGCGT
GAGCCGGACGAGGAAACCGCGATCCGCATGTTACGCGGAATAGCTGAGACCTTCATGGCCCATCATGGGG
TAAAGATCCGTGACGAGGCTATCGTCGCTGCCGTGCAACTTTCTGCCCGCTTTCTTCCAGCCCGCCAATT
GCCTGATAAGGCGGTCAGCCTGATCGATACCGCCGCAGCCACGGTTTCGCTGGCGCGCCAGACGGTGCCG
GAACAATTACTGCTTCTTAAAAGCGAGCTTGCGCATCTCACGGTCGAGACCGACTGGCTTGCCCGTGAGC
CAGAAAATACGGATGTGCAGGAGCGCCGCCAGGCCGTGACCACTGAAATGGAGCGCCTGGCTAAGGAAAT
CGATAGCCTCCAAGCGCGCTATGATGCTGAAATTGCAGCGCTGGCAGCGAGTGACGAAGCGCCCGCCGTA
GACAGTGATAAGATGGCGTCGAAGGATGCTCCTGATGTTAACGTCACACCATTGATCACTCCTCTGCGGA
CACGGGGGCTTGTCCGCCGCGCGGCGTCTCTGGCGCCGACCTCCGCTGGCGAAGAAAAGCTTGTACCGCA
TGAGGTCGATCGCAATGTTGTTGCCGCCGTCCTGGCGCGGTGGACCGGCATTCCTCTGGGCAAACTGCTG
GCCGACCAGATTGAAAGCGCAAAAAGCCTCGATATGAGGTTGAAGGAAAAGGTAATCGGCCAGGATGCCG
CACTGGAACGGATCGGTGACGCCATGCGTGCGGCGCGCGCCGGGCTTTCCGATCCACGTCGTCCGCCTGC
CGTGTTCATGCTGGTCGGCATGTCGGGAACCGGTAAAACCGAAACCGCGCTGACCCTGGCTGATCTGATG
TATGGTGGTAGCCAACATCTGACGACGATCAACATGTCGGAGTTCAAGGAAGAGCACAAAGTATCCATGC
TGCTGGGTGCTCCTCCAGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGACCGAAGCCGTGCGGCGTCG
GCCCTATGGCGTGCTGTTGCTCGACGAAATCGACAAGGCGCATCCCGGTGTCCAGGACATTTTCTATCAG
GTCTTCGACAAGGGAATGTTGCGCGATGGCGAAGGCCGCGATGTTGACTTCCGCAATACCACGATTTTCA
TGACGGCCAATACCGGCTCGGAATTGCTGGCCTCCTTGGCCCTTGATCCAGACACCATGCCCGAAGGTGA
GGCGTTGGAAGCATTGTTGATGCCGGAACTGCAAAAGCAGTTCAAGCCGGCCTTCCTCGGACGCACGCTG
CTGTTGCCGTTCATGCCGCTTGGCAAGGAGGCCCTGTCGCGGATCGTCGATATCCAGATCAACCGCATTC
GGGAGCGTATTTTTTCGGCCTATGGCACAGAGCTTGCTCTGTCCGAAGAGGCCCGCAATGCGCTGGTCGG
ACGCGCTGTTGCAAGTGAGATCGGAGCTCGTGCCATCGAAATCATGATTGGCCGGGATCTGTTGCCGCCG
CTTTCCAGCTTCTTCCTTGAGCTGGTCGCATCTGGCGCAAAGGTTACCGAAGCTCTGGTAACCCATGATG
AAAAAGGGTTCGGCGTTCGCGCCGGGGCCGCTGGGGAAAAAGAGGAATTCGCCGATGCCTCGGGTGCATC
GGTGGATAAGGATGCCGCGTCGGAAGGGGTATCCAGACGCATGCGGCAGTGA