SecReT6
Protein ID: 222106991
SecReT6 ID329
T6SS typei5
Gene symbol-
Locus tagAvi_6054
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1075761..1076237 [+]
Producthypothetical protein
NoteTssD
UniProt IDB9K2G8
KEGG IDavi:Avi_6054
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-34, Aligned region: 4..134
Protein Sequence: 158 a.a.     [Download]
>gi|222106991|ref|YP_002547782.1| hypothetical protein Avi_6054 [Agrobacterium vitis S4]
MPIYLKVDGIQGDATHEEHRNWMDIEAIHWNVSRAMNTTAGSTANREASEPAISEVILTKVSDSSSTKLF
QEACAGRTGKQAVIHMVTTGNPGNTYIEYTLTNTLIANYSVDSSGDRPVETIKLNFTKIEVKYTPYDDQN
NPKSPMIASYDLSTTKAA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|222106127|ref|NC_011988.1|:1075761-1076237 Agrobacterium vitis S4 chromosome 2, complete genome
ATGCCGATTTATCTGAAGGTCGATGGTATCCAGGGTGATGCGACCCACGAAGAGCACCGCAACTGGATGG
ACATCGAGGCTATTCACTGGAACGTTAGCCGCGCCATGAACACCACGGCTGGTTCTACCGCCAACCGTGA
AGCCTCTGAACCCGCAATTTCCGAAGTCATCCTGACCAAGGTCAGCGATTCCTCTTCCACGAAATTGTTC
CAGGAAGCCTGCGCTGGCCGCACTGGCAAGCAAGCGGTGATCCACATGGTCACCACCGGCAATCCCGGCA
ATACCTATATCGAATACACGCTCACCAACACGCTGATCGCCAATTATTCCGTCGATTCCAGTGGTGACCG
TCCGGTCGAAACCATCAAGCTGAACTTCACCAAGATCGAAGTGAAGTATACGCCTTACGACGACCAGAAT
AACCCGAAGTCGCCGATGATCGCATCTTACGATCTGTCGACCACAAAGGCTGCGTAA