SecReT6
Protein ID: 222157500
SecReT6 ID796
T6SS typei2
Gene symbol-
Locus tagLF82_426
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2926406..2926906 [+]
Producthypothetical protein
NoteTssB
UniProt IDE2QQR0
KEGG IDelf:LF82_426
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|222157500|ref|YP_002557639.1| hypothetical protein LF82_426 [Escherichia coli LF82]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNFNSVMAEF
SPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2926406-2926906 Escherichia coli LF82, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGATCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTCAACAGCGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTAATGAACAAAATATCGCGCTTG
AATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATATTCCGCAGCTTCGTGTATTACT
CGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA