SecReT6
Protein ID: 222157503
SecReT6 ID796
T6SS typei2
Gene symbol-
Locus tagLF82_429
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2929857..2930522 [+]
Producthypothetical protein
NoteTssL
UniProt IDE2QQR3
KEGG IDelf:LF82_429
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|222157503|ref|YP_002557642.1| hypothetical protein LF82_429 [Escherichia coli LF82]
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLTLVLAGVWWGLHYWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2929857-2930522 Escherichia coli LF82, complete genome
ATGAAAAAAGATATGGATATCAATATCGATGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATCGAGCTGTATCGCCACTGTCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCACAGTGCGCCCTG
CTGGACGAAACGGTGCTCAGCCGTAGTGGCATGGACGACGGTCAGGCCATCTGGATGAAAAACCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAACGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTGACGCTCACACTGGTACTGGCCGGTGTCTGGTGGGGGCTACATTACTGGCTGAACGTG
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA