SecReT6
Protein ID: 222157507
SecReT6 ID796
T6SS typei2
Gene symbol-
Locus tagLF82_433
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2935564..2938038 [+]
Producthypothetical protein
NoteTssI
UniProt IDE2QQR7
KEGG IDelf:LF82_433
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-63, Aligned region: 34..351
Phage_GPD [PF05954], Evalue: 4.00E-63, Aligned region: 590..617
DUF2345 [PF10106], Evalue: 5.10E-39, Aligned region: 577..596
DUF2345 [PF10106], Evalue: 5.10E-39, Aligned region: 602..753
T6SS_Vgr [PF13296], Evalue: 3.70E-35, Aligned region: 484..589
T6SS_Vgr [PF13296], Evalue: 3.70E-35, Aligned region: 589..614
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 396..477
Protein Sequence: 824 a.a.     [Download]
>gi|222157507|ref|YP_002557646.1| hypothetical protein LF82_433 [Escherichia coli LF82]
MEALMNVQFFDHAHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAIAPESVLMQDGAFSLTA
PPVQGMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRER
HQMRGQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGL
TLPLRHPSGLFDGETEAVWGLNTAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADN
FLQQGDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTTSA
ARDRSYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKP
GYESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTP
ANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKEQRGEGFELRTDLWGAVRAKKGIFISADAQDK
AQGQVLEMQPALARLSAALVTMESLAASAQQAQALAADVSRQQTLLQQKIEQLQQEVLLGSAPKGVALVS
GEDMQLSASDNLTLTAGKQLDIGVQKDFTLAAGKQLSLYSRAGAKLFSSHNDIDIQAQGGNLTTWSTQDT
YISSGKKLVVTAQDELTLICGGGYIKIKSGNVEIGGPGKLLVKNAGIKKAGSGSMQGVMKSFEPESFDEN
FIISNPASGKPIANQKYEIHMPDGSVIAGITDAMGYSSLVASKASDDLKIILKK
 
Nucleotide Sequence: 2475 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2935564-2938038 Escherichia coli LF82, complete genome
ATGGAGGCTCTTATGAACGTACAGTTCTTCGACCACGCACACCACAAGCTCAAAATTCGCGGCCTGCAAA
GTCCGGTGGATGTGCTGACCTTTGAAGGCCGCGAGCAACTGAGTACCCCGTTCCGCTACGACATTCAGTT
TACCAGCAGCGATAAAGCCATCGCGCCGGAGTCGGTGCTGATGCAGGATGGCGCATTCAGCCTGACGGCA
CCGCCGGTACAGGGAATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCGGCTTTAAAC
ATCTCTCATCGTCACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCG
CAGCCGCCAGAACGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGG
CACCAGATGCGCGGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGC
AGTACGGTGAGGACGACCTGACGTTTGTTTCACGCCTGCTGTCAGAGGTGGGTATCTGGTTCCGCTTTGC
CACCGACGCCCGGTTGAAAATCGAAGTTATCGAATTTTACGACGACCAGAGCGGCTACGAGCGCGGGCTG
ACGCTGCCGCTTCGCCATCCTTCTGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACCG
CGTACAGCGTGGTGGAAAAAAGTGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATGAC
CACAGGCCAGCATGACGCCACCGGGGGCGATAACACCACTTACGGCGAAGCCTACCACTATGCCGACAAC
TTCCTGCAACAAGGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGTCACGAACGCT
ACCTGAATGAACAGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAA
AGTTCAGGGCGACGACGCGCCTGCGGTGTTCCGCAAGGGCGTGCTGATTACCGGCGTGACGACCAGCGCG
GCGCGTGACCGCAGCTATGAGCTGACGTTCACGGCGATACCGTACTCAGAACGCTACGGCTACCGTCCGG
CGCTAATCCCCCGCCCGGTCATGGCCGGAACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATAT
CTATGCCCATATCGACAAGGACGGGCGCTACCGAGTCAACCTTGACTTTGACCGCGATACGTGGAAACCG
GGTTATGAAAGCCTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGC
TGCTGGCGGGAACGGAGGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACAGGCCGTATATCGCCGGGGT
AAAACACGACTCGGCGCACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTGCGTACCCCG
GCCAACAACAAAATCCGGCTGGATGACGAGCGCGGGAAGGAGCATATCAAGGTCAGTACCGAATATGGCG
GCAAGAGCCAGCTAAACCTCGGCCATCTTGTTGATGCCGGGAAAGAACAGCGTGGCGAAGGCTTTGAACT
GCGTACCGATCTGTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCTGATGCGCAGGATAAG
GCGCAGGGTCAGGTGCTGGAGATGCAGCCAGCTCTGGCTCGCCTTTCTGCAGCGTTGGTGACAATGGAAT
CTCTGGCTGCCAGTGCGCAACAGGCTCAGGCACTGGCGGCAGATGTGAGTCGTCAGCAGACGCTGTTGCA
GCAAAAAATTGAGCAGTTACAGCAGGAAGTGCTACTGGGTAGCGCACCTAAGGGCGTGGCGCTTGTCAGC
GGTGAGGATATGCAGTTGTCTGCCAGCGATAATCTGACTCTGACAGCAGGTAAGCAACTGGATATTGGCG
TACAGAAAGACTTTACGCTGGCAGCAGGAAAACAGCTCAGCTTGTATAGCCGTGCGGGAGCAAAGCTCTT
TAGCTCACATAACGATATTGATATTCAGGCGCAGGGGGGAAATCTGACCACCTGGTCAACACAGGACACC
TATATATCGAGTGGTAAAAAGCTGGTGGTGACAGCGCAGGATGAGTTAACACTGATTTGTGGCGGGGGCT
ATATCAAAATTAAAAGTGGCAATGTGGAGATTGGCGGTCCGGGAAAACTATTGGTTAAAAATGCCGGTAT
TAAGAAAGCAGGCTCCGGTAGTATGCAGGGCGTGATGAAGTCGTTTGAGCCTGAAAGTTTCGATGAAAAT
TTCATTATTTCGAATCCAGCATCAGGTAAGCCGATAGCAAATCAAAAATATGAAATACACATGCCAGATG
GGAGTGTTATTGCCGGGATAACCGATGCAATGGGGTATTCCTCTCTTGTTGCGTCAAAAGCATCTGATGA
CCTAAAAATTATTCTGAAAAAATGA