SecReT6
Protein ID: 222157513
SecReT6 ID796
T6SS typei2
Gene symbol-
Locus tagLF82_439
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2945903..2947513 [+]
Producthypothetical protein
NoteTssA
UniProt IDE2QQS3
KEGG IDelf:LF82_439
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.30E-21, Aligned region: 66..126
Protein Sequence: 536 a.a.     [Download]
>gi|222157513|ref|YP_002557652.1| hypothetical protein LF82_439 [Escherichia coli LF82]
MSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDSGYHDDFLRIRDEMNKLSGADTDLI
CQLAESLLLTQTKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALEWLAGE
KMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEDQHSPSLMPLINALESRLAQSGGMNAVVPQNSSS
VPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAP
PRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALAKAGAPWDRWTAVIRQDLTLLL
ERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLIARVAEQYGKNEMALLLLEELDIATQGITLTQWEPELLFEVKARQ
LKLLRLRAHRYADKALLNRKMDALLGTLVAINPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2945903-2947513 Escherichia coli LF82, complete genome
ATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCGACCGGGATGCACTGGATGTGGCGCGAA
CACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAGATACGCCGGTCGGGGAAGACTCCGG
CTACCACGACGATTTTCTGCGTATCCGCGACGAGATGAACAAACTTTCCGGCGCGGATACGGACCTCATC
TGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGACAAAAGACGTGCGCATCGCCACTTACTACATCTGGG
CGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACTGGCGCTGCTGACCGGACTGGTGGAACG
CTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAAATGGCGCTGGAGTGGCTGGCGGGGGAA
AAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAGAGGATTTTGCGAACATTGTTGCTGCTC
TTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGACCAGCATTCCCCCTCCCTGATGCCGCTGAT
TAACGCGCTGGAATCACGTCTGGCGCAGTCGGGTGGGATGAATGCGGTGGTGCCGCAAAACAGCAGCAGC
GTTCCTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGACCATCACCTCCGGGCGCGACCTGCTCG
ACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTCAGCACACCGGCTGAT
GAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGATGTGGACGGCAAAACCCGGCTGGCCCCG
CCGCGCACAGAATCGCGCAACCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGACGGAACTGCTGGAGC
AGGCCGACCTGATGTTCAGCACCGGTGTCAGCCATTTCTGGCTGGACATTCAGTGGTATCTGCATCAGGC
GCTGGCCAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGTTATCCGTCAGGACCTGACGTTACTGCTG
GAGCGCCTGCCGGGACTGGAAAATCTGGCATGGAACGACGGCACACCGTTCGCCGACGAGGTGACGCGCA
ACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAAAGCCGCTGTACCGAC
AGACGACGCCACAAACGACGTACTGGCGCTGGAGCCGGAAGCGCTGGAGATGGCAGACAGTCAGGGCGTG
GAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGACAGCGCCTGTTATTGCGGC
TGCTGATCGCACGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCTGCTTGAAGAACTGGA
TATTGCCACACAGGGAATAACGCTGACGCAGTGGGAGCCAGAGCTGCTGTTTGAGGTAAAAGCCCGACAA
CTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAGCCCTGCTGAACCGAAAAATGGATGCCC
TGCTGGGTACACTGGTGGCAATCAATCCGGTGCGGGCGGCGGTACTGTGTGATACGCAGCATAAGGAGTG
A