SecReT6
Protein ID: 222157519
SecReT6 ID796
T6SS typei2
Gene symbol-
Locus tagLF82_445
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2952909..2953337 [+]
Producthypothetical protein
NoteTssE
UniProt IDE2QQS9
KEGG IDelf:LF82_445
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-17, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|222157519|ref|YP_002557658.1| hypothetical protein LF82_445 [Escherichia coli LF82]
MSTPSLYEMLTFSFSGELPLEQISERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2952909-2953337 Escherichia coli LF82, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGATCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGCCGGGCAGGCAC
GCTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGGATGGCTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACACTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AATTACTCCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAACAGGAGCGG
GCGTACTGA