SecReT6
Protein ID: 224582107
SecReT6 ID330
T6SS typei3
Gene symbol-
Locus tagSPC_0276
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]301753..302748 [-]
Producthypothetical protein
NoteTssG
UniProt IDC0Q6N5
KEGG IDsei:SPC_0276
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-94, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|224582107|ref|YP_002635905.1| hypothetical protein SPC_0276 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHD
RFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLKDYLRFLPGGNNLPVLTELVRTFIGFEYC
WEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRQVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|224581838|ref|NC_012125.1|:c302748-301753 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGACCGGCGCTCTCGACCAGGCGCAGAAAACCCCCTGGCGTTACGGATTCCTGAACCTGATGCGGCGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCAC
TGAACCGCTCAGAGAGTCGCCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACCACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCCGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCAGCCTCCGCCCATCTGGTACGCGAATCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAGTTCGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTTACGCTGAAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATCGGTTTTGAATATTGC
TGGGAAATTGAGCTGCAGTTGAAGCCTCATGCCGCACCGCCTGCGGTGATCGGCGGCGCGCAGCGGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCAGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA