SecReT6
Protein ID: 224582113
SecReT6 ID330
T6SS typei3
Gene symbol-
Locus tagSPC_0282
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]307216..309855 [+]
ProductClpB-like protein
NoteTssH
UniProt IDC0Q6P1
KEGG IDsei:SPC_0282
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 609..776
AAA [PF00004], Evalue: 3.50E-19, Aligned region: 236..368
AAA [PF00004], Evalue: 3.50E-19, Aligned region: 381..402
AAA [PF00004], Evalue: 3.50E-19, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 3.50E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 277..315
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 345..406
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 469..518
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 236..402
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 676..697
Sigma54_activat [PF00158], Evalue: 4.60E-06, Aligned region: 232..252
Sigma54_activat [PF00158], Evalue: 4.60E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 614..634
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 614..644
AAA_19 [PF13245], Evalue: 7.90E-05, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 7.90E-05, Aligned region: 386..413
AAA_19 [PF13245], Evalue: 7.90E-05, Aligned region: 430..456
AAA_19 [PF13245], Evalue: 7.90E-05, Aligned region: 612..636
Zeta_toxin [PF06414], Evalue: 8.30E-05, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 8.30E-05, Aligned region: 318..404
Zeta_toxin [PF06414], Evalue: 8.30E-05, Aligned region: 608..664
AAA_25 [PF13481], Evalue: 0.00025, Aligned region: 236..335
AAA_25 [PF13481], Evalue: 0.00025, Aligned region: 473..530
AAA_25 [PF13481], Evalue: 0.00025, Aligned region: 609..640
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 612..639
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 236..316
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 382..403
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 613..696
AAA_17 [PF13207], Evalue: 0.0031, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.0031, Aligned region: 614..650
P33MONOX [PF15302], Evalue: 0.0044, Aligned region: 156..194
P33MONOX [PF15302], Evalue: 0.0044, Aligned region: 452..523
AAA_18 [PF13238], Evalue: 0.0047, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.0047, Aligned region: 616..647
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 615..636
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 215..251
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 290..318
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 381..409
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 613..628
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 612..633
Protein Sequence: 879 a.a.     [Download]
>gi|224582113|ref|YP_002635911.1| ClpB-like protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEK
ALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALTARIFSLNNEL
TASESRWQRELELVHTLQELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSVAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
KLFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLPLDETSRGVIAHLHLDRLVARMSEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPQLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|224581838|ref|NC_012125.1|:307216-309855 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGCTCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAA
GCGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGCGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GCCCTTACGACGGCTCCGGCCTGGCATCAGCCATTCCCGGTGAAAGCAGCCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGCTGGCGAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATA
ATCCACTACTGACTGGTGAGGCGGGCGTCGGAAAGACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGC
GCAGGGGGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTGCTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGGCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCCATCAGCCTGCTGGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGCCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGACGGCGCGAATTTTCTCGCTCAACAATGAACTG
ACTGCATCCGAATCTCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTGTCGCAG
AGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGCAGGGCGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGTGGCGGTTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCCGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCGGAGGCTATCTACGGCGGTGAGCAGAACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCGC
ACACCGTTTCCACGCTGAAAGGCGCGCCCCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCAGTGCGTCGCCACCCCTGGAGTGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAC
AAACTCTTCTATCAGGTGTTTGACAAGGGTGGGATGGAGGACGGCGAGGGTACACATGTCGATTTCAAAA
ACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCTTT
AATGCCCGACGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTACGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCCGCTGGACGAAACGTCGCGTGGCGTGATTGCCCATCTGC
ACCTTGACCGGCTGGTGGCGCGGATGAGTGAACAGCACGGCGTGACGCTGACGTATAGCGAGGAACTGGT
CGCACATATTGTGGCGTGCTGTCCAATGCATGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAG
CACATCCTGCCGCAACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCCGCTATCAGGCAAATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGATCGTTTGCTGA