SecReT6
Protein ID: 224582114
SecReT6 ID330
T6SS typei3
Gene symbol-
Locus tagSPC_0283
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]309955..310497 [+]
Producthypothetical protein
NoteTssB
UniProt IDC0Q6P2
KEGG IDsei:SPC_0283
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.40E-60, Aligned region: 11..163
Protein Sequence: 180 a.a.     [Download]
>gi|224582114|ref|YP_002635912.1| hypothetical protein SPC_0283 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLENLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|224581838|ref|NC_012125.1|:309955-310497 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGCTCTGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACCCAACTGGAGAACCTCCAGACCTACATGGATGGTAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACCCTGCTGAAAACGCTGGCGAATGCGCCGA
AACCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA