SecReT6
Protein ID: 224582119
SecReT6 ID330
T6SS typei3
Gene symbol-
Locus tagSPC_0288
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]313790..314281 [+]
Productlipoprotein
NoteTssJ
UniProt IDC0Q6P7
KEGG IDsei:SPC_0288
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-41, Aligned region: 5..155
Protein Sequence: 163 a.a.     [Download]
>gi|224582119|ref|YP_002635917.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIP
GKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|224581838|ref|NC_012125.1|:313790-314281 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCCGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATACGTGTTTATGAACTAAAAAATGACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATACCG
GGGAAAGGAAAAGTGCAGTTGGAGGCGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAAT
GA