SecReT6
Protein ID: 225382145
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0002
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]01679..2470 [-]
ProductDotu family type VI secretion protein
NoteTssL
UniProt IDC0LZM0, C0LZM0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-54, Aligned region: 46..248
Protein Sequence: 263 a.a.     [Download]
>gi|225382145|ref|ACN89286.1| Dotu family type VI secretion protein [Vibrio alginolyticus]
MSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLSIDNMGINPLVDQFSWLIASLSCMSSIPWLDD
PMPFREQVAREIRKGERKLNEMELDRASVLVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFHNETSG
GDKFFVILDRLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGSTIYRLVRDDRLAEQEKVS
LINLKAKYLKKPLKRVISPKLILSLSAMTFALMYAATYIVIDLKFQQLLEMYR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0002|:1679-2470
ATGAGTTACGCAGAAACCGACGTCACCGTAGTCTTATTCCAACCAGAGCCTGGCAAACCAATGGAGGTAA
TGCCAGCGCCTGACTTGTCGAGAAACATCGCAGTACAAGATCTATCTATCGACAACATGGGTATTAACCC
GCTAGTGGACCAGTTCTCATGGTTGATCGCCAGTCTGTCTTGTATGTCTTCGATCCCTTGGCTTGATGAC
CCGATGCCATTTCGTGAACAAGTGGCACGTGAGATTCGAAAAGGTGAACGAAAACTTAATGAAATGGAGC
TCGATCGTGCTTCGGTTCTTGTTATTCGTTACTGCTTGTGTGCGGCGATTGATGAATCTGTTTGTCGACA
AGAGTGGGGGGCAAATAGTCACTGGAGCCAGAACAGCTTACTGTCTGAATTCCACAACGAGACATCTGGT
GGTGACAAGTTTTTCGTTATTCTCGACCGCTTAAAAGCCGACCCTCGCAAATACCGTCACGTTATAGAGT
TTCTCTATTTATTGCTTCAACTTGGTTTCCAAGGCAAGTACGGCCGTGAAGAGCGTGGCAACGAAAAGCT
AGCGGAAATTGGCAGCACCATTTATCGATTAGTGCGAGATGACCGCCTAGCAGAACAAGAAAAAGTTTCT
TTAATCAACCTTAAAGCTAAATATCTAAAGAAGCCGTTAAAAAGGGTAATTTCACCCAAGCTGATCTTAA
GTCTTAGTGCGATGACGTTTGCGCTTATGTATGCGGCAACCTACATCGTCATAGACTTAAAATTTCAGCA
ACTGCTTGAAATGTATAGATAA