SecReT6
Protein ID: 225382146
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0003
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]2467..3792 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDC0LZM1, C0LZM1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|225382146|ref|ACN89287.1| type VI secretion protein [Vibrio alginolyticus]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSLLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTMESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDDSFIPTCIDIHASTVLSKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASSEAVHPESLYRILLQAEGELSTLCSTTRRP
IEFTKYNHGDLTSCLSRVLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDNKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWMALKNTAA
IAIHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0003|:2467-3792
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCATTTTCAACAACTCG
ATCGTTCGCAAAGTAAACTATCGAGCCTACTGAGTGCCAATGCATCGCCTTTGCATTGGGGAATTAAACG
TTTAGAAATCAACTCTCAGTTACTAGCACTGGGTAAAATCGGTATTACTCGTGCTGAAGGTATTTTACAA
GACCGGACACCATTTGAGCTTCCGTTGCTTGCTGAGCTGCCTGAAGTGAAAGATGTAGATCCTTCGATTG
CCGATAAAGTCGTTTATTTGTGCTGTCCGTTACCATCGGAACGTTCTGAGTTATTTGGTACCAAAAAAGA
CGGTGCGCGCTATACGATGGAATCTCAAGAAGCGGTTGACGCTTGTTATGATTCGGAAGACATGGCAAAT
ATCGTCGTCGGTAAGCTTAACTTTTGCTTAATGTACGATCATGAAGATAAGAGTGCTTACACGTCTATTC
CGATCTTAAAGATCTCAGAAGTGAAGCCTGATGGCAGCGTGATCTTAGATGATAGTTTCATTCCTACCTG
TATCGATATTCATGCGTCGACAGTACTGAGTAAATTTGCGACCGAGTTTGCTTCTATGTTGAAGCATCGC
GCGGAATCGATAGTCCAGCGATTAGGGGTGGTGGATCAACAAGGCGTATCATCGGTTTCTGACTTTATGC
TATTGCAAGCGCTCAACCGATACGAACCCTTGTTTTGGCATTTCGCAAGCTCAGAAGCTGTGCATCCTGA
GTCTTTGTATCGAATTCTTCTTCAGGCAGAAGGTGAGCTTTCGACGCTGTGCTCAACGACACGCCGACCT
ATTGAGTTTACGAAGTACAATCATGGTGATCTTACTAGCTGTCTTTCTCGCGTCCTAGACAGTGCGAAAA
TGACATTGAGCGTGATGTCTGAGCAAAGAGCAATTCCACTGACCTTAAAAGATCAGAACTATGGCATCAG
AACGGCAGCAATCCCTGACAATAAGATCATTGATACGACAACCTTTATCCTCGCAGTTAAAGCCGACGTG
ACCTTGGATGTTCTGCATACCCAGTTTGTCAGCCAAACGAAGATCGGTTCTATCGATAACATACGTGACT
TGATTAACCTTCAACTGCCTGGGATTGAGATCAAACCAATGCCAGTTGTGCCACGCGCGCTGCCGTATCA
TGCTGGCTACACCTATTTCGAGCTCGATAAAACGGGCGAAGAGTGGATGGCGTTGAAGAACACTGCTGCG
ATTGCGATTCACGTTGCGGGCGATTTCGCTAACTTATCATTGCAACTTTGGGCCGTTCGTCTATGA