SecReT6
Protein ID: 225382147
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0004
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]4297..5571 [-]
Producttype VI secretion system FHA-containing domain protein
NoteFha
UniProt IDC0LZM2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 424 a.a.     [Download]
>gi|225382147|ref|ACN89288.1| type VI secretion system FHA-containing domain protein [Vibrio alginolyticus]
MVNGNKILKNQPVAIVDGDIISLGQYEIGVSLEHVTSTLDIAADIAPERVSSDPLVSLGDAVVEEEEKVG
ALEDLFMETKQDDIDCHDPVAHLNFSMQRDDDYLIRDNERTESEQPRTVESTCQVVDDSFSIYSEFDQPS
LIPEDWMAAETKSNASVNDALAPESGKAHRADIASAEVMQPGTVAPDSTIQRQHRTPNVTEMVVEQANTG
SKWEEMTQSFTPSPNTNQQLQIPTAEHAINSTTKAQVDTDAAVCSQDIAQAFFDGLGIRNPELMTNEAQL
FKQMGTCLRLCIDNLQKELHEVESLKDEQSASEANSNIAELMLTLNSQQLLAPNELVEQMLDELNDHQVM
FNKALNELVLEQSETNDPVAFANRVASQSLFSTKSKLWAEYLDFYTNNRRLLNETSLKGLIKKNYNKVIK
GNHA
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0004|:4297-5571
ATGGTAAATGGGAATAAAATACTAAAAAATCAACCCGTTGCGATAGTTGATGGCGACATCATTTCTTTAG
GGCAATATGAGATTGGTGTTTCTCTTGAGCACGTTACCTCAACACTAGACATCGCCGCTGATATTGCTCC
TGAGCGAGTATCTAGCGATCCTCTGGTTAGTCTAGGAGATGCGGTTGTCGAAGAGGAAGAAAAAGTCGGT
GCCTTAGAAGATTTGTTTATGGAGACTAAACAGGATGACATTGATTGTCATGATCCTGTTGCTCACCTTA
ACTTTTCGATGCAGCGAGATGACGATTACTTAATTCGTGATAATGAGCGTACAGAATCTGAACAACCTAG
AACCGTGGAAAGCACGTGTCAGGTGGTCGATGACAGTTTCAGTATATATTCCGAATTCGATCAGCCAAGC
CTAATCCCTGAAGACTGGATGGCTGCGGAAACCAAGAGTAACGCATCGGTCAATGATGCATTAGCGCCAG
AAAGCGGTAAGGCACATAGAGCCGATATTGCCTCAGCTGAGGTGATGCAACCTGGCACGGTAGCCCCAGA
TAGCACGATTCAAAGACAACATCGTACGCCTAATGTTACTGAGATGGTCGTAGAGCAGGCTAACACAGGG
TCAAAATGGGAAGAGATGACCCAATCTTTTACGCCTTCTCCTAACACTAATCAGCAACTTCAAATACCTA
CGGCAGAGCACGCGATAAACAGTACGACGAAAGCACAAGTCGATACTGATGCGGCCGTTTGCTCTCAAGA
TATAGCGCAAGCGTTTTTTGATGGTTTGGGTATTCGAAATCCAGAGTTGATGACAAACGAGGCGCAGTTA
TTCAAGCAAATGGGCACTTGCTTGCGTTTATGTATTGATAACCTACAGAAAGAGTTGCACGAAGTGGAAT
CGTTAAAAGATGAGCAGAGTGCGAGTGAGGCTAACTCGAACATTGCAGAGCTAATGCTCACTTTGAATAG
TCAGCAATTACTGGCTCCAAATGAACTGGTTGAACAAATGCTCGATGAGCTGAACGATCACCAAGTTATG
TTTAACAAAGCACTGAATGAGCTCGTTTTAGAACAGTCAGAAACGAACGATCCCGTAGCATTTGCTAACA
GGGTCGCTAGCCAGTCTTTGTTCTCAACTAAGTCAAAGCTGTGGGCCGAATACCTAGATTTCTACACTAA
TAATCGTCGCCTGCTTAATGAAACATCCTTAAAAGGGCTGATTAAGAAAAACTATAACAAAGTGATTAAG
GGAAACCATGCGTAG