SecReT6
Protein ID: 225382149
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0006
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]6951..8264 [+]
Producthypothetical protein
NoteTssA
UniProt IDC0LZM4, C0LZM4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-15, Aligned region: 46..104
Protein Sequence: 437 a.a.     [Download]
>gi|225382149|ref|ACN89290.1| hypothetical protein [Vibrio alginolyticus]
MFFTDFARRPIDENNPSGSNPNGSEDFDEIKRQINNLNKVTGRVSWKTVQTLSKKILSTQAKDLRCCCYF
TVASTYNDGLRGLVEGLNSILDVCVVYWFNAYPEHSKSKARMSAIEWMVEHTEKRINKHRALPEELPLIE
AAHQLCLRIEEELRLHYGIEAPSLGRIRRILNQWIEQIKEQQIAAELREKKQANTSAPAATQKAPEIKVN
VSPSPAPVSSPNLNSQEKASPAKSGRFMIYFVIGLIVTAICSHFMYEQQRYRTLEQKINQASLNELVNLV
ASLDYENKKYAQSLKTQAINRVDIMMNNWFLDSAKVSNVSELDSLTNELIAIYPDSSSAQQLRQNFLTQS
AHLEDQFMDVYKRFSDARTVFANVARQNVDKNSEKAYEYSNSLFPLLGRIEYAEKYSQQKEIDRATLLLN
IYLYKLSQLQAEKTDNK
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0006|:6951-8264
ATGTTTTTTACCGACTTCGCTCGAAGACCAATCGATGAAAATAACCCAAGCGGCTCTAATCCTAATGGTT
CTGAGGATTTTGACGAAATTAAACGTCAAATAAACAACCTGAATAAAGTCACAGGGAGAGTCTCGTGGAA
AACGGTTCAAACACTCTCAAAAAAGATCTTGAGTACCCAAGCGAAAGACCTACGTTGTTGCTGTTACTTT
ACCGTTGCGTCAACCTATAACGACGGCTTAAGAGGCCTTGTTGAAGGGTTAAACTCAATACTTGATGTGT
GTGTCGTATATTGGTTCAACGCGTATCCAGAGCATTCAAAGTCAAAGGCACGAATGAGCGCTATTGAATG
GATGGTAGAGCATACTGAAAAACGAATTAATAAGCATCGGGCGTTACCAGAAGAGCTTCCATTGATAGAG
GCAGCACATCAATTATGCTTGAGGATTGAGGAAGAGCTTCGTCTTCATTACGGTATTGAAGCGCCGTCAT
TAGGTCGCATTCGCCGTATTTTGAATCAATGGATTGAGCAGATAAAAGAACAACAAATTGCGGCTGAGTT
ACGCGAGAAAAAACAAGCCAACACTAGCGCTCCTGCAGCAACGCAGAAGGCACCTGAAATTAAAGTGAAT
GTGTCTCCCTCTCCCGCACCGGTGTCATCACCCAACCTAAATAGCCAAGAGAAAGCATCACCGGCAAAGT
CTGGTCGATTTATGATCTACTTCGTTATTGGTTTGATTGTTACTGCGATATGTTCACATTTCATGTACGA
GCAACAACGTTATCGAACATTGGAGCAAAAAATTAATCAAGCTTCACTTAATGAACTTGTAAATTTGGTC
GCCTCGTTAGATTACGAAAATAAAAAATATGCTCAGTCATTGAAAACGCAGGCCATTAATCGTGTCGATA
TTATGATGAATAACTGGTTTTTAGACTCGGCAAAAGTAAGTAACGTCAGCGAGCTCGATAGCTTGACCAA
TGAATTAATCGCAATCTATCCGGATTCGTCTTCTGCACAGCAGCTACGTCAAAACTTTTTGACACAGAGC
GCCCATTTAGAAGACCAGTTTATGGATGTTTATAAGCGATTCTCAGACGCAAGAACGGTGTTTGCCAACG
TAGCTAGACAGAATGTAGATAAGAACTCTGAAAAGGCGTACGAATACAGTAACTCGTTATTCCCGCTTTT
AGGTCGTATTGAATACGCTGAAAAGTATTCACAGCAAAAGGAAATTGACCGCGCAACCCTTTTACTGAAC
ATCTACCTATATAAATTGAGTCAGCTACAAGCTGAAAAAACTGACAATAAATAA