SecReT6
Protein ID: 225382152
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0009
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]12220..12741 [-]
Producthypothetical protein
NoteTssG
UniProt IDC0LZM7, C0LZM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-38, Aligned region: 8..158
Protein Sequence: 173 a.a.     [Download]
>gi|225382152|ref|ACN89293.1| hypothetical protein [Vibrio alginolyticus]
MQDCEVAELDRAKVLSYVNQLSTRTRSPKLISGIVSHYFSLPNVRIEEWVYRRVEIAESQRNKLNRSNCV
LGQSLHLGQSIADLNGKFNLCIDNIDFETFKQFSYDGELHKTLVGLMRFILRDPMSWDLKLTVNLDSIPE
NKLGNGEGNQLGQTFWLGNPGDKDAKIRLIGSI
 
Nucleotide Sequence: 522 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0009|:12220-12741
ATGCAAGATTGTGAAGTAGCGGAGTTAGATCGAGCGAAAGTTCTGTCTTACGTGAACCAGTTATCTACGC
GTACACGCTCACCCAAGCTTATTTCCGGTATTGTTTCGCACTACTTTTCACTGCCGAATGTGCGAATCGA
AGAATGGGTTTATAGACGCGTAGAAATCGCTGAAAGCCAGCGTAACAAACTCAACCGCTCCAATTGTGTA
TTGGGGCAAAGCTTACACTTGGGACAAAGCATTGCGGATTTGAACGGCAAGTTTAACTTGTGTATCGACA
ACATTGATTTTGAAACGTTTAAGCAGTTTTCCTACGATGGTGAGTTACATAAGACGCTGGTGGGCTTGAT
GCGCTTTATTCTGCGTGACCCAATGTCGTGGGACCTAAAGTTGACAGTTAACCTAGACAGTATTCCAGAA
AACAAACTGGGTAATGGAGAAGGGAACCAACTAGGTCAAACGTTCTGGCTTGGTAACCCAGGTGATAAAG
ACGCCAAAATTCGACTTATCGGAAGCATATAA