SecReT6
Protein ID: 225382153
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0010
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]13544..15079 [-]
Producthypothetical protein
NoteTssF
UniProt IDC0LZM8, C0LZM8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-158, Aligned region: 5..466
Protein Sequence: 511 a.a.     [Download]
>gi|225382153|ref|ACN89294.1| hypothetical protein [Vibrio alginolyticus]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTSPRPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSMIDVTLSTEHGLELSRIGLDTLRLHLHGEIHITRTVFLWLFRYLDYFELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQEFFSLPDKFMFFDIKGLEWLKGIPQRSTVKIKFHFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLATIDVVERVALPLTTSPLQTDRKAT
RAYPTCAQLFFAQYGCVKVVL
 
Nucleotide Sequence: 1536 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0010|:13544-15079
TTGAGTAACAGTAAATACTTTCAAGATGAACTCACGTATTTACGCGAGTCGGGTAGTGAGTTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACTTTTGATCCAGATGTCGAACGATTGCTGGAAGG
TTTTGCTTTTTTGACCGGACGCATCCGCGAAAAGATTGACGATGAACTTCCTGAGCTAACGCAATCTCTG
ATGACTTCCCCGCGCCCACATTACATGCGTTCGATCCCGTCTTTGTGCATTAGCGAACTAAAACCGCATA
CCGGAAGTGTTACTGAGAAAACCGTGGTGAAACGTGGTGCGGAAATGGCTAGCGAGCAGGTAGAAGGCAC
GCAGTGTTTGTTCCGTACTTGTTATGACGTCAATCTATACCCAATTACGATTACTAACATTGAACAAACT
AACAGCCGCACCAGTTCGATGATTGATGTAACGTTATCGACGGAGCATGGCCTTGAGCTGTCTCGGATAG
GTTTAGACACGCTGCGATTGCACCTGCATGGTGAGATTCATATTACTCGCACTGTCTTCTTATGGCTGTT
CCGTTATCTAGATTACTTCGAGTTGGATGTTGGTGGCGGCTACAAACATCGTTTAGGGCCAGAATACGTT
AAGCCAGTCGGGCATGAAGAGGACGAGGCGCTGTTGCCCTACAGCAAAAACTCCTTTGCAGGCTACCGTT
TGCTGCAAGAATTCTTCTCTTTGCCAGATAAGTTCATGTTCTTCGACATTAAAGGCTTAGAGTGGCTAAA
AGGCATTCCACAGCGCAGTACGGTCAAAATCAAATTCCACTTTAAGCGTGCTTTGCCTTCAGAGGTGGTG
CTTAAAGATAAACACTTAAGGTTGCACTGCACACCTGCCGTTAACTTGTTTGAAAAAGACGGCGATCCAA
TCCGTTTAGAGCATCGACGAAACGAGTACAAGGTGCGTCCACAAAGTAACACTCAGGAGCATTACGAGGT
TTATTCCATTGAGCAAGTGGAGAGCTGGAGTAAAGACGAGCGTCGCCGAAAACCACTGATTGAATTTGAA
TCGTTTGAGCACCAAATCAACCAGCGTGATAAGCGAGAGTTCTACAAATCCAAAGTGGGCGAGCGAGTAA
GTGGGAGAGGGTTAGAGCGCTATATCTCATTCCATACTCACAATGGTGACATTGCGGATTTAGGGACTGA
AACAGTATTGATGAAACTGCAATGCAGTAACGCAGACTTAGCGGAGCGCCTGTCAGTAGGAGATATCACG
TACGCGACGCACAAATCGCCAACGTATGCGACGTTTAAAAACATTACTAAGCCAACACAGTCAGTAAGTC
CTCAGGTTAATGGTGAACTTCAATGGCAGTTGATTGCCAACATGTCGCTCAACTACTTGTCTTTGGCCAC
TATCGATGTGGTTGAAAGAGTTGCTCTTCCACTTACGACTTCCCCTCTCCAGACCGATAGAAAAGCAACG
CGCGCATACCCAACATGCGCTCAATTATTTTTTGCCCAATATGGATGTGTGAAAGTTGTGCTCTGA