SecReT6
Protein ID: 225382154
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0011
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]15090..15500 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDC0LZM9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.00E-21, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|225382154|ref|ACN89295.1| type VI secretion system lysozyme-related protein [Vibrio alginolyticus]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHSHLADLLNTHSGNAMIDNEYGLPDFNDVLSNNTNLV
RHIQKNITSTIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0011|:15090-15500
ATGGAAAAAGGTTACCGTCTTTTAGAGCGGATCGAGCTAGGAGAACCAAAAAACTGCTACGAGAAAGTGG
TGTCTCATAAGCATTTGATTGAATCCATTCACTCGCATCTCGCTGACTTGTTGAATACGCATTCCGGCAA
CGCAATGATCGACAATGAGTATGGTCTGCCAGATTTTAACGACGTACTTTCTAACAACACGAACCTCGTT
CGCCATATTCAAAAAAACATCACGTCAACCATAGAACGCTTTGAGCCCCGACTGCTGAATGTCGAGGTTC
ACTACCGTGAAGACCACCATAACCCATTACAACTCGGCTTTGGTATTCGCGGCGAAGTTTCCCATAACGG
CGGTAAAGTCCCAATGTCGATCGATGTCTACATGGGAACCGACGGCCAATTTAACGTTTAG