SecReT6
Protein ID: 225382155
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0012
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]15562..17037 [-]
Producthypothetical protein
NoteTssC
UniProt IDC0LZN0, C0LZN0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-187, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|225382155|ref|ACN89296.1| hypothetical protein [Vibrio alginolyticus]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYAMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYAKWRGLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEQVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGTVQDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0012|:15562-17037
ATGTCTGCAGAAGCACAAGCGCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTTAACGAAACACGTTTAAAGCCAAGTGATGAAGGTTTTGACGTTGCAAAACGCGGCGTAGAAGCATT
CATCAGTGAGCTACTAAGCAGTTCGAACACAGAGAAAGTCGACCAATCTCTGGTTGATCTGATGATCTCT
GAAATCGACCAAAAATTGTCTAAGCAAGTTGATGCAATTCTTCACAACGAAGAAGTTCAAGCGATTGAAT
CAACGTGGCGTGGCCTTAAGTACCTGGTTGATCACACTGACTTCCGCGAGAACATTCAAATTGAACTGAT
CTCTGCGAAGAAAGACGAAGTTCTTGATGACTTTGAAGACGCTCCAGAGGTGGTGAAGTCTGGCCTGTAC
AAGCAAATCTACACACGTGAATACGGCCAGTTCGGTGGTAAACCTGTTGGCGCCGTCATTTGTGATTACG
CTATGTCTGCCTCTTCGCCTGACATCAAACTGATGGAATACATGGCGAACGTAGGCGCAATGTCTCACGC
ACCATTCATCACGTCGGCATCGGCTAAATTCTTTGGCCTAGACAGCTATGAAGAGCTGCCAAACCTAAAA
GATCTGAAGTCTGTATTCGAAGGTCCACAGTACGCGAAATGGCGTGGTCTGCGTGAGCACGAAGATGCAC
GTTATTTAGGTCTATGTACGTCTCGCTTTATGTTACGTACGCCTTACTCTGTAGAAGATAACCCAATTAA
GGCGTTTGACTACGATGAGCAAGTGACAGACAGCCATGATAACTACCTATGGGGTAACTCAGCGTACGCG
ATGGCGTCTAAGATCAGTGAATCATTTGCTAAGTACCGTTGGTGTCCGAACATTATTGGCCCTCAAAGCG
GTGGTACTGTACAAGATCTACCGGTTTACAACTTTGAAGCTATGGGTCAAATCGAGACTAAGATCCCAAC
CGAGATCCTGGTTTCTGACCGTCGTGAGTACGAGCTAGCGGAAGAAGGCTTCATTGCGCTAACCATGCGT
AAAGGTTCTGACAACGCGGCGTTCTTCTCTGCAAACTCTGTTCAAAAGCCGAAAGTGTTTGCGAATACGC
CGGAAGGCAAACAAGCAGAGATGAACTACAAGCTAGGTACTCAGCTTCCTTACATGTTCATTATCAACCG
TTTAGCGCACTACATCAAAGTGCTACAGCGTGAGCAAATTGGTTCTTGGAAAGAGCGTTCTGACCTAGAA
ATCGAACTGAACAAGTGGATTCGTCAATACGTTTCTGACCAAGAGAACCCGCCAGCGGAAGTTCGTGGTC
GCCGTCCGCTTCGTGCTGCGAAGGTTGAAGTATCAGACGTAGAAGGCGATCCAGGTTGGTACAAAGTATC
GATGTCTGTGCGTCCTCACTTCAAGTACATGGGCGCAAGCTTCGACTTGTCTCTAGTTGGTAAGCTAGAC
CAATAA