SecReT6
Protein ID: 225382156
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0013
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]17046..17552 [-]
Producthypothetical protein
NoteTssB
UniProt IDC0LZN1, C0LZN1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.30E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|225382156|ref|ACN89297.1| hypothetical protein [Vibrio alginolyticus]
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNEVLEGMS
PNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEGARKKLLDELSIGNDQDAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0013|:17046-17552
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGCGATA
CGCAAGAAGACGTAGAGCTGCCGCTAAGCATGATGGTAGTTGGCGACTTTACTGCGCGTGCAGATGAGAC
ACCAATTGAAGAACGTACTCCAATTAACATCGACAAAGACAACTTTAACGAAGTGCTAGAGGGCATGTCT
CCAAACGTTAAAGTCAACGTTGAAAACCGTCTTTCTGATGAAGAAGGCGGCCAGATTGGTGTTGATCTGA
CGTTCCAAAACATGAAGGACTTCTCACCTGAAGCGATCGCGAAAAGTGTACCTGAACTAAACAGCCTACT
TGAGCTTCGCGAAGCCTTGGTTGCACTTAAAGGTCCTCTAGGAAATGTTCCTGCGTTCCGTAAGAAGATC
GCATCGGTTCTTCAAGATGAAGGAGCGAGAAAGAAACTGTTGGATGAACTAAGCATTGGCAACGACCAAG
ACGCGAAAGAAGAGTAA