SecReT6
Protein ID: 225382157
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0014
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]17579..19243 [-]
Producttype VI secretion system-associated VCA0119
NoteTssA
UniProt IDC0LZN2, C0LZN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-18, Aligned region: 48..108
Protein Sequence: 554 a.a.     [Download]
>gi|225382157|ref|ACN89298.1| type VI secretion system-associated VCA0119 [Vibrio alginolyticus]
MSNIDIDRLLNPISDESPVGNDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHATEVLEHHSKDLKAI
CYLVRALTEEFGLQGFEQGLKLLSEALSRFGVELYPSRKRGRDGAVEWLNHQFKLVSSKLAKSAQSWDLV
SNCISTIEEVQRQYDEVYQDSEADFFEIRTQLNVLSQQAAADEQSDDAVVNVEQAAPAPATQSAAEETPA
ADEQSDDAVVNVEQAAPAPATQPAAAETPAQSEVQTAPVKAVPPAPKPAPVKKAVAKEVDVDTDFSSPTA
SKRTLKKVAEVMLHANPSDPLAYRIYRHLTWDDIDGLPDHQNNQTPLSLAVSSDQQAEYRDKADQESDID
TIKRLERTLTDAPFWLTGHYFVYSMLNNLGFDDAALAVKQEVTRFVESLEGIEHLSFKNSIPFADEATLS
WLSTQDTTSSTSQPVVQTVVISQEDSLPMEDITLENLGECAAELAHKLELDSSGRGQFMLYLQLIAAYQS
VGLYPLCLPYLEKGWEVQKAFNLASWEPHLSSQLEDLIRKTLHRLFGSKDLLPEKYEEWKAIYD
 
Nucleotide Sequence: 1665 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0014|:17579-19243
TTGTCCAACATTGATATCGATCGTCTGCTTAATCCTATTTCTGATGAATCTCCAGTGGGAAACGATGCCC
GTTACGAGTTTTGCTATGAAATGATGGAGTCCGAAGTGAAGAAATTCGGTTCCTTGTTTGGCGAAACAGT
AGATTGGAGCGTGGTAAAAACGCACGCGACTGAAGTTCTAGAGCACCACAGTAAAGACTTAAAAGCCATT
TGTTACCTCGTTCGCGCGCTAACAGAAGAGTTTGGTCTGCAAGGCTTTGAACAAGGTCTAAAGCTGCTTA
GTGAGGCGTTAAGTCGCTTTGGCGTTGAATTGTATCCTTCGCGAAAGCGGGGTCGAGATGGCGCGGTCGA
ATGGTTGAACCATCAGTTTAAACTGGTCAGCAGCAAGTTAGCGAAAAGCGCTCAGTCATGGGATTTGGTA
TCAAACTGCATTTCGACTATTGAAGAAGTGCAGCGCCAGTACGACGAGGTTTACCAAGACTCAGAAGCGG
ATTTCTTTGAGATTCGCACTCAACTCAATGTTTTATCTCAACAAGCGGCGGCTGATGAGCAGAGCGATGA
TGCAGTCGTTAACGTCGAACAAGCGGCGCCTGCACCAGCTACGCAGTCTGCTGCCGAAGAAACGCCAGCG
GCTGATGAGCAGAGCGATGATGCAGTCGTTAACGTCGAACAAGCGGCGCCTGCACCAGCTACGCAGCCTG
CTGCCGCAGAAACGCCAGCGCAGAGTGAAGTGCAAACCGCACCGGTGAAGGCGGTTCCGCCGGCCCCTAA
ACCTGCGCCAGTTAAGAAAGCGGTAGCAAAAGAAGTCGATGTCGATACGGACTTCTCTTCGCCGACGGCT
TCTAAGCGCACCTTGAAGAAGGTTGCGGAAGTCATGCTTCATGCGAACCCAAGTGATCCGCTGGCTTACC
GGATTTATCGTCATCTGACTTGGGATGACATTGATGGTCTACCCGACCACCAAAATAATCAAACGCCTTT
GAGCTTGGCAGTGTCGTCCGATCAACAAGCGGAATACCGAGATAAAGCTGACCAAGAAAGCGACATCGAC
ACGATTAAGCGTTTGGAGCGCACATTAACGGATGCGCCGTTTTGGCTGACGGGCCATTACTTCGTGTATT
CGATGCTTAATAACTTGGGCTTTGATGATGCAGCGCTTGCTGTGAAACAAGAAGTGACGCGTTTTGTTGA
ATCGCTAGAGGGCATCGAGCACCTCTCATTTAAGAATTCTATACCATTTGCAGATGAAGCGACCTTGAGC
TGGTTATCGACTCAAGATACTACTTCTTCGACTTCTCAACCCGTTGTTCAAACGGTTGTGATTTCGCAGG
AAGACTCGCTGCCAATGGAGGATATCACTCTAGAAAATCTAGGGGAATGTGCCGCAGAGCTTGCCCACAA
ACTTGAGCTGGATAGCTCGGGACGTGGGCAGTTCATGCTGTATTTACAATTGATAGCAGCTTACCAGTCT
GTTGGATTATACCCGTTGTGTTTGCCGTATCTTGAGAAGGGGTGGGAAGTACAAAAAGCGTTTAATCTCG
CGAGCTGGGAACCCCACTTATCGTCACAGTTAGAAGACCTAATTCGAAAAACACTCCATCGGTTATTTGG
AAGCAAGGATCTTCTACCTGAGAAGTATGAAGAGTGGAAAGCAATTTACGACTAA