SecReT6
Protein ID: 225382163
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0020
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]25276..27354 [-]
Productputative VgrG protein
NoteTssI
UniProt IDC0LZN8, C0LZN8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-69, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 1.10E-69, Aligned region: 501..537
Phage_base_V [PF04717], Evalue: 5.20E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 4.50E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 4.50E-05, Aligned region: 534..542
Gp5_C [PF06715], Evalue: 4.50E-05, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 4.50E-05, Aligned region: 569..591
Gp5_C [PF06715], Evalue: 4.50E-05, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 4.50E-05, Aligned region: 616..636
DUF2345 [PF10106], Evalue: 0.0093, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0093, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|225382163|ref|ACN89304.1| putative VgrG protein [Vibrio alginolyticus]
MVNDAEFKFEVPGCGHEFRVESFHVHEELSKPFHINLSLLSLDPDISFDELIRKAGTLTLYGQGVGAARV
FNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAQDIITEVLDDGAVTDYRFEVSGTYP
PKEYVLQYRESDLHFVQRMMAEHGMWYYFDHSDSNHTMVIVDSNDAIAPLISSPLNASYIGPIVYHADGG
GVADREHISDLELVNRVRTGQVTYTDYNYEHPKIPQEMTQAGELDQDLKQFDYPGRYVDPLMGQVRTTEW
MSEHIVDNQQVEATSDAMRLASGYSFNVSDHPRSEINRDYLMLSVMHTGQDPQVHEDEASGMPTTYYNQF
SCIPRDVVFKAPKLAAPVVDGPQTAVVVGPEGEEIYTDKLGRVKVQFHWDRYGDNNEHSSCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIHGHKTTQVNSTFTETVEQ
DVTVTYNANEAQYVKNNSDLEIGDNRTTKIGKNDDLDIGENSNLTIGASKSSDIGADDNQTIGGNLTVSV
KGNTAYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSAITIEGSDKVVVKGGNVVVN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0020|:25276-27354
ATGGTGAATGACGCAGAATTTAAATTTGAAGTGCCTGGATGTGGGCATGAATTTCGGGTTGAGAGCTTTC
ATGTTCATGAAGAGTTATCTAAGCCTTTCCACATCAATCTCTCATTACTTTCACTTGATCCAGATATCTC
GTTCGATGAGTTAATACGTAAAGCAGGAACATTGACACTTTACGGACAAGGTGTTGGGGCTGCGCGTGTG
TTCAACGGCGTGGTGAATGAAGTTCGTTACTTAGGGACTGGACGTCGTTTTTCTCGTTATCAATTAGTCT
TGGTTCCTCAAGCTTGGTTCTTATCTCAGCGCCAAGATTGTCGTATTTTCCAGCAAAAGTCAGCGCAAGA
CATCATCACAGAAGTACTCGATGATGGGGCAGTCACCGATTACCGATTTGAAGTGTCGGGTACTTATCCC
CCAAAAGAATACGTTCTGCAATACCGTGAGTCTGACTTGCACTTCGTGCAGCGTATGATGGCCGAACACG
GTATGTGGTATTACTTTGACCATAGCGACTCAAATCATACGATGGTCATTGTCGACAGTAATGACGCGAT
TGCACCTTTGATAAGCTCGCCACTAAATGCTTCTTACATTGGGCCGATTGTTTATCATGCCGATGGTGGC
GGTGTTGCCGATCGCGAACATATCTCTGATCTCGAGTTAGTTAACCGCGTTAGAACGGGACAGGTTACGT
ACACAGATTACAACTACGAACACCCTAAAATTCCACAAGAGATGACACAGGCTGGCGAGCTAGACCAAGA
TCTCAAGCAGTTTGATTATCCTGGACGATACGTTGACCCGCTGATGGGTCAGGTGAGAACCACGGAGTGG
ATGTCGGAACACATAGTCGATAATCAACAAGTGGAAGCAACGAGTGACGCAATGCGCTTAGCATCTGGTT
ACAGCTTTAACGTCAGTGACCACCCGCGTTCTGAGATTAACCGCGATTACCTCATGTTGTCTGTAATGCA
CACAGGTCAAGATCCGCAAGTGCATGAAGATGAAGCGAGTGGTATGCCAACCACTTACTACAACCAGTTC
TCGTGTATTCCACGTGATGTGGTGTTTAAAGCGCCTAAATTAGCAGCACCAGTGGTTGATGGCCCTCAAA
CGGCGGTTGTTGTAGGACCAGAAGGTGAAGAGATTTACACTGACAAGCTTGGTCGAGTGAAAGTACAGTT
CCATTGGGATCGCTACGGTGATAACAACGAGCATTCAAGCTGTTGGATTCGTGTAAGCCAATCCATGGCG
GCGCCAACATGGGGCGCAGTTTATTTGCCGCGTATTGGCCACGAAGTCGTAGTAACTTTCCTTGAGGGGG
ACCCAGATCGTCCGTTAGTTACGGGCGCAGTTTACAACGGTTTGCATTTCCCACCGTACTCTTTGCCAGA
AAACAAAACTCGTACCACGTTCCGCACGCAAACGCACAAAGGAACAGGTTACAACGAGTTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTATATTCACGCTCAAAAAGACATGTCGACCAAGGTGCTCAACAACC
GTTACCGTGATATCGGTCAAGATGAATTCTTGAAGGTTGCACGTCACCAAACGAATGAAGTTCATGGTGA
CCATAAAGAAACCATTCATGGGCATAAAACGACACAGGTAAACAGTACGTTTACGGAGACAGTCGAGCAA
GACGTTACCGTCACATACAACGCGAACGAAGCCCAGTATGTGAAAAACAATTCTGACTTAGAAATTGGTG
ATAACCGTACGACTAAGATCGGTAAAAATGATGACTTAGATATTGGCGAAAACAGTAACCTTACTATCGG
TGCGTCTAAGAGTTCAGATATTGGTGCGGATGATAACCAGACGATTGGTGGCAACTTAACGGTATCAGTG
AAAGGGAACACCGCTTATAAAGCCGATGGTGCAACGCAAATTATCAGTGGCGACAAGATTGTATTGAAAA
CGGGTGGCTCCTCTTTAGTGATGAACAGTGATGGTTCAATAAAGTTATCAGGCTCGGCTATTACGATCGA
AGGCAGTGATAAAGTCGTCGTGAAAGGTGGCAACGTAGTGGTTAACTAA