SecReT6
Protein ID: 225382165
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0022
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]28396..31080 [+]
ProductATPases with chaperone activity ATP-binding subunit
NoteTssH
UniProt IDC0LZP0, C0LZP0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.90E-45, Aligned region: 221..271
AAA_2 [PF07724], Evalue: 5.90E-45, Aligned region: 628..792
AAA [PF00004], Evalue: 1.50E-22, Aligned region: 222..350
AAA [PF00004], Evalue: 1.50E-22, Aligned region: 633..757
AAA_16 [PF13191], Evalue: 4.30E-15, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 4.30E-15, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 4.30E-15, Aligned region: 406..505
AAA_16 [PF13191], Evalue: 4.30E-15, Aligned region: 607..655
AAA_16 [PF13191], Evalue: 4.30E-15, Aligned region: 697..726
AAA_16 [PF13191], Evalue: 4.30E-15, Aligned region: 839..839
ClpB_D2-small [PF10431], Evalue: 7.50E-15, Aligned region: 799..874
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 153..182
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 222..240
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 294..350
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 632..790
AAA_22 [PF13401], Evalue: 9.30E-10, Aligned region: 220..316
AAA_22 [PF13401], Evalue: 9.30E-10, Aligned region: 630..745
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 220..278
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 436..472
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 632..753
AAA_17 [PF13207], Evalue: 4.20E-06, Aligned region: 222..285
AAA_17 [PF13207], Evalue: 4.20E-06, Aligned region: 631..655
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 220..247
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 275..315
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 628..664
IstB_IS21 [PF01695], Evalue: 4.60E-05, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 4.60E-05, Aligned region: 632..652
IstB_IS21 [PF01695], Evalue: 4.60E-05, Aligned region: 742..762
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 142..172
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 300..342
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 631..672
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 222..247
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 279..320
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 632..657
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 629..654
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 220..237
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 275..300
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 584..654
AAA_18 [PF13238], Evalue: 0.00048, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.00048, Aligned region: 497..540
AAA_18 [PF13238], Evalue: 0.00048, Aligned region: 633..661
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 200..233
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 272..305
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 630..653
DUF258 [PF03193], Evalue: 0.0027, Aligned region: 190..238
DUF258 [PF03193], Evalue: 0.0027, Aligned region: 630..653
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 222..241
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 633..654
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 734..751
AAA_23 [PF13476], Evalue: 0.0086, Aligned region: 222..237
AAA_23 [PF13476], Evalue: 0.0086, Aligned region: 436..503
AAA_23 [PF13476], Evalue: 0.0086, Aligned region: 629..744
AAA_33 [PF13671], Evalue: 0.0087, Aligned region: 221..237
AAA_33 [PF13671], Evalue: 0.0087, Aligned region: 418..442
AAA_33 [PF13671], Evalue: 0.0087, Aligned region: 631..652
Protein Sequence: 894 a.a.     [Download]
>gi|225382165|ref|ACN89306.1| ATPases with chaperone activity ATP-binding subunit [Vibrio alginolyticus]
MAMININLSSLIQRLHPIAKVALEDAAALAVSEKANEVQIEHYLLSLLERPNSDFDVLLSHFDCSENLLR
QSVRSTLDTSAKGNGSKPVFSALLIEWLQESWLVSSLDLSETQIRSGALLLTLVSNPLRYGQHGYASILE
AVNPDSLKRNFAELTSQSIEAQVATSEKTQAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIVDI
LARRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGVELYGLDMGLLQAGASVKGEFEKRLNAVL
DEVKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRF
QLVKLDEPSPEQAALIIRGLRPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACARVNI
SLNAIPASVETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLKLAMETTKEELAEQEAQWHKEKEQ
IQEMIALRSRLHELVFGETNEEELVAEEDSEQEQNVSPYAEMDEETVRIAISACQEQLDVIRNGNPLVHF
EVGPDEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEYAIDALSEGIQTAKAGLSNPDAPTG
VFLLVGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQR
PYSVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKDIDANI
IAEAIRPTLNQHFKPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLQSHHKLSLSYEESLVEFVLGN
CRLAETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQITVSVDEQGTLTYAFS
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0022|:28396-31080
ATGGCTATGATAAATATAAACCTTTCTTCATTAATTCAGCGTCTACACCCGATTGCAAAAGTAGCATTAG
AAGACGCCGCTGCACTTGCAGTCTCTGAAAAAGCAAACGAAGTTCAAATTGAGCATTATTTACTGAGTCT
ATTAGAAAGACCAAATAGTGATTTTGACGTCTTATTAAGTCATTTTGATTGTTCTGAGAACTTATTAAGA
CAATCGGTTCGATCCACACTCGACACCAGCGCCAAAGGAAATGGCAGCAAACCTGTTTTTTCTGCGTTAT
TAATCGAATGGTTACAAGAAAGCTGGCTGGTTTCTTCTTTAGATCTATCCGAAACACAAATCCGCTCTGG
TGCCCTACTCCTTACTCTTGTTAGCAACCCTCTCCGTTACGGCCAACATGGTTACGCCTCTATCCTTGAA
GCGGTAAACCCTGACAGCCTTAAGCGTAACTTTGCAGAGCTAACAAGCCAATCTATTGAGGCGCAAGTTG
CTACTTCAGAGAAAACACAAGCTCGTGAGGATGGCTCAGCACTGAGCAAGTTCACAACAGACTTCACTGG
TAAAGCACGCAAAGGCGAAATCGATCCTGTTTTCTGCCGCGACCAAGAAATCCGCCAAATCGTGGACATT
CTTGCTCGTCGCCGTAAAAACAACCCTATTGCTGTTGGTGAACCGGGCGTTGGTAAAACCGCAGTAGTAG
AAGGCTTGGCACTTAAGATTGTACAAGGTGACGTACCAGACAACCTCAAAGGTGTTGAGCTTTACGGGCT
AGATATGGGTCTTCTGCAAGCTGGTGCAAGCGTAAAAGGTGAATTCGAAAAACGCCTAAACGCGGTATTG
GATGAAGTGAAAAACTCGCCAACCCCTATCATTCTTTTCATCGATGAAGCACACACCCTTGTTGGCGGTG
GTAACCAAGCGGGCGGCAGCGACGCGGCAAACTTGCTAAAACCAGCCCTAGCGCGTGGTGAAGTGAAAAC
CATCGCCGCAACAACATGGTCGGAATACAAGAAGTACTTCGAGAAAGATCCTGCCCTTGCACGTCGTTTC
CAATTGGTGAAACTCGACGAACCGTCTCCTGAGCAAGCAGCATTGATCATTCGTGGTCTGCGCCCAGCAT
ACGAGAAGTCACACAACGTTTACGTGCGTGACGATGCTATCACTGCTGCGGCAGCACTTTCTGCTCGTTA
CATCTCTGGTCGTCAACTGCCAGACAAAGCGATCGATGTACTAGATACGGCGTGTGCACGAGTGAACATC
AGCCTTAATGCCATTCCTGCTTCTGTTGAGACTCTGCAACAAGAACTTGCAGCTCAACAGCGCGAGCTTG
AAGCACTTGAGCGTGATGCTCTGCAGCAAACTGGCGACAAGCACAGCCTTGCTAACATTCCAGACCTAAA
ACTGGCAATGGAAACAACGAAAGAAGAGCTAGCAGAACAAGAAGCGCAATGGCACAAAGAAAAAGAGCAG
ATCCAAGAGATGATTGCTCTACGCTCTCGTTTGCATGAACTGGTCTTTGGCGAAACAAATGAAGAGGAGC
TTGTTGCAGAAGAAGATTCAGAACAAGAGCAAAACGTTTCTCCATATGCAGAAATGGATGAAGAAACCGT
TCGCATTGCAATTTCGGCCTGCCAAGAGCAGCTAGATGTAATCCGCAATGGCAACCCACTGGTTCACTTT
GAAGTGGGTCCAGATGAAGTTAGCCACGTCATCTCGGACTGGACTGGTATTCCTATGGGTAAGATGCTTC
AAGACGAAGCAGAAACCACGCTAAAACTGAAAGAAAGCCTAACACAAAGCATCAAAGGCCAAGAATACGC
TATCGATGCACTGTCTGAAGGCATTCAAACTGCGAAAGCTGGTCTAAGTAACCCAGACGCACCAACAGGC
GTATTCCTGCTGGTTGGCCCAAGTGGCGTGGGTAAAACCGAAACGGCCCGTGCGATCGCAGATCAAATGT
TTGGTGGTGAGCGCTTTATGACGACCATTAACATGTCTGAGTTCCAAGAGAAGCACACGGTATCACGCCT
AATTGGTTCACCTCCGGGTTACGTAGGTTACGGTGAAGGCGGCATGCTGACAGAAGCGGTTCGTCAACGT
CCATACTCTGTTGTTCTTCTTGATGAAGTGGAAAAAGCCGACCCTGAAGTATTGAACCTGTTCTACCAAG
TGTTCGACAAAGGCACGCTGAACGACGGCGAAGGCCGCACAATCGACTTCAAGAACACGCTGATCATCAT
GACCAGTAACCTTGCGACGCATGAGATCGAATCTTTGGTTCATCAATCAAAAGACATCGATGCGAACATC
ATCGCAGAAGCTATTCGCCCTACTTTGAACCAACACTTCAAGCCGGCGCTGTTGGCACGTATGTCAGTAC
TACCATTTGTTCCGCTGTCTGATGAAGCAATGACAGAAATTATTCACCACAAGCTGAACAAAGTTTCTCA
GCGTCTACAGAGCCATCATAAATTGTCTCTGAGCTACGAAGAAAGTTTGGTTGAGTTCGTACTAGGTAAC
TGTCGCCTTGCTGAAACGGGCGCGCGTAACATCGACGCGGTCATCAACCGTCAGTTACTGCCTCAGCTAT
CGACACAGCTATTGGTGCATGATAAGGATGATTCACACACGCAAATCACAGTTTCTGTCGATGAGCAAGG
AACACTGACCTATGCGTTCAGCTAA