SecReT6
Protein ID: 225382176
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0610
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]9464..10756 [+]
Producthypothetical protein
NoteTssL
UniProt IDC0LZQ0, C0LZQ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-62, Aligned region: 49..254
OmpA [PF00691], Evalue: 5.60E-14, Aligned region: 251..272
OmpA [PF00691], Evalue: 5.60E-14, Aligned region: 322..420
Protein Sequence: 430 a.a.     [Download]
>gi|225382176|ref|ACN89316.1| hypothetical protein [Vibrio alginolyticus]
MEQTIVKPTPGGRAHASKPQSEKSLDNTVVISKSPELVNNDSVVAYGNNSLLAEANGLLSIIGQIRSTAT
HSDPLFLKETLAQKLRDYENRSRQHDVDLDTIDTARYCLCCSLDEVVLNTNWGGHSFWSHDSLLSSFYAS
SQGGEAFFKHLDKCMAKPDANLDLLELMYVCLSLGFLGQYRLEKNGLESHRKLRRQVIATLKSYGRGVPQ
ELSNSIDQHILNGSKASDRAPLWVVCSVTAALLVCIYMYFSYELNKASNRTFSQLVNLIQPQQLNQDATS
ESKSAPIAEKISMYLATEIGKGLINVEPLQDRVRISLKSQDLFESGSADVVAYIQPVISKLARTLESTQG
KIIVTGHTDDRPIFTSKYPSNWHLSLARATAMSEQLISNSALEGRVIPEGLGDARPLVENSSDENRAINR
RIEIDLLVAN
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0610|:9464-10756
ATGGAACAAACGATCGTAAAACCAACACCGGGTGGAAGAGCACACGCATCGAAACCACAATCAGAAAAGT
CACTGGATAATACCGTAGTTATCTCAAAAAGCCCTGAATTGGTGAACAATGATTCAGTGGTCGCTTATGG
GAATAACTCTCTACTAGCAGAGGCGAATGGCCTGTTATCTATTATCGGTCAAATTCGGTCGACAGCGACT
CATTCCGATCCGTTGTTTCTAAAAGAGACATTGGCACAAAAGCTTAGAGATTATGAGAACCGATCACGTC
AGCATGACGTTGATTTGGATACCATTGATACAGCTCGTTATTGTTTATGCTGTTCACTAGATGAAGTTGT
CCTTAACACCAATTGGGGTGGGCATTCATTCTGGAGTCACGATTCATTACTCAGCTCCTTCTATGCTAGC
AGTCAAGGTGGGGAAGCGTTCTTTAAGCATCTTGATAAGTGCATGGCGAAACCAGATGCGAACTTAGATT
TGCTTGAACTAATGTATGTGTGCTTATCTCTCGGGTTTCTGGGTCAATACCGTTTAGAAAAAAATGGACT
GGAATCGCACCGGAAATTGAGAAGACAGGTTATTGCTACTCTTAAGTCTTATGGGAGAGGAGTCCCTCAG
GAGCTAAGTAATAGTATCGACCAACACATTTTGAATGGCTCAAAGGCTTCTGATAGAGCCCCTCTTTGGG
TTGTATGTTCTGTAACGGCGGCATTATTGGTCTGCATATATATGTATTTTAGCTATGAGCTAAATAAGGC
ATCCAATCGCACCTTTTCTCAATTAGTCAATTTGATTCAACCGCAACAACTTAACCAAGATGCAACGTCA
GAATCAAAATCAGCGCCAATTGCAGAAAAGATTTCAATGTATCTAGCAACTGAGATCGGTAAGGGGCTAA
TCAATGTTGAGCCGCTGCAAGACAGGGTAAGAATTTCGTTAAAGTCTCAAGATCTATTTGAATCAGGTAG
TGCTGATGTTGTCGCTTACATCCAACCCGTTATTTCTAAGCTTGCGAGAACATTGGAGTCGACCCAAGGC
AAGATCATTGTTACTGGTCACACCGACGATAGGCCTATTTTCACGAGTAAATATCCCTCGAACTGGCACC
TATCATTAGCTCGAGCCACTGCTATGTCTGAACAACTGATCTCGAATAGTGCATTAGAAGGGCGAGTGAT
ACCCGAGGGATTGGGGGATGCAAGACCATTAGTTGAAAACAGTAGTGATGAAAACCGAGCTATTAACCGC
CGGATTGAAATCGACCTTCTTGTCGCGAATTAA