SecReT6
Protein ID: 225382180
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0614
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]15765..16880 [+]
Producthypothetical protein
NoteTssA
UniProt IDC0LZQ4, C0LZQ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-21, Aligned region: 67..127
Protein Sequence: 371 a.a.     [Download]
>gi|225382180|ref|ACN89320.1| hypothetical protein [Vibrio alginolyticus]
MSNEMFDWYEQALAPISQENPTGIDPREDVSPQSAYYRLKDQRMAARNAERNALIEEESIYTHSNLWRVF
IEDVPEILTNQSKDLEFVAWLIEALTRLYGFRGMGVGYKLATSLIENFWDDLYPMPDDDGIETRISAIIG
LNGIDSEGTLIFPIACIPLTDLGVEQAYAYWEYQQAIELERLDEDKRRNRVELGAVELSEIITTVKSTSD
TFYQELITDLEFATESFNEFSQRLDEAVGDVTPSSYISKRLESIHSALKHLLGDRFNQPQAVFEELEDLD
ESSSEQPLSSQSCDALLATNMKSREQAIRQLQQVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAELI
SDGDAEKSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0614|:15765-16880
ATGAGTAATGAAATGTTTGATTGGTATGAACAAGCGTTGGCTCCTATATCTCAAGAAAATCCTACAGGTA
TTGATCCTAGAGAGGATGTATCACCACAGTCTGCTTACTATCGGTTGAAAGATCAGCGTATGGCCGCCCG
CAACGCTGAACGTAATGCTCTTATAGAAGAAGAAAGTATCTATACCCACAGTAATTTATGGCGAGTATTT
ATTGAAGATGTCCCAGAAATACTCACGAATCAGTCTAAAGATTTGGAATTTGTTGCCTGGCTTATAGAAG
CCCTAACTCGATTGTATGGTTTTCGTGGTATGGGCGTTGGCTACAAACTCGCAACCAGTTTAATTGAGAA
CTTTTGGGATGATCTGTACCCAATGCCTGATGATGATGGTATTGAGACAAGAATATCGGCGATTATTGGC
CTCAATGGTATCGATAGTGAAGGAACACTTATTTTTCCAATTGCTTGTATACCATTGACTGACTTAGGCG
TGGAGCAAGCTTATGCCTATTGGGAATATCAGCAAGCTATAGAGCTTGAGCGCTTAGACGAAGATAAGCG
CCGAAATCGAGTCGAGCTTGGGGCTGTTGAGCTATCTGAAATTATAACTACGGTTAAGTCGACTTCTGAT
ACGTTTTATCAAGAATTAATCACGGATTTGGAGTTCGCTACAGAATCATTTAATGAATTCAGTCAGCGAT
TAGACGAAGCGGTCGGTGATGTGACTCCTAGCTCTTATATATCAAAAAGACTCGAATCAATACACTCGGC
ATTAAAGCACCTTCTAGGAGATCGTTTCAATCAACCACAAGCCGTGTTTGAAGAGCTAGAGGATCTTGAT
GAATCTTCTTCTGAACAACCGTTAAGTTCACAAAGTTGTGATGCATTATTAGCGACAAACATGAAATCAC
GAGAGCAGGCAATTAGACAATTGCAGCAAGTAGCTGATTTCTTCCGAGAGAGTGAACCTCACTCACCAGT
TTCTTACTCCATCGAACAGATCATTCGTTGGTGTGGGATGCCTCTGCCGGAGTTACTGGCGGAACTTATC
TCCGACGGGGATGCAGAGAAAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATTAA