SecReT6
Protein ID: 225382181
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0615
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]16896..17426 [+]
Producthypothetical protein
NoteTssB
UniProt IDC0LZQ5, C0LZQ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.90E-62, Aligned region: 8..162
Protein Sequence: 176 a.a.     [Download]
>gi|225382181|ref|ACN89321.1| hypothetical protein [Vibrio alginolyticus]
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMNPSVKFKVANKLANDDSQFEVDLNFKSMQDFEPAAIVNQVDPLRQLMETRNKLRDLMTKVDRSEEL
ENILEDVLNNTDNLARLAGELDLDKKAKSDSTEGAE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0615|:16896-17426
ATGACGAGTATCCACTCGAAACTATCACGAGTACGGAAGCCTCGTGTCCACATTACCTATGATGTTGAAA
CTGAAGGTACAACTCTTAAGAAAGAACTGCCTTTTGTTGTAGGTGTAATGGGTGATTTCGCTGGTCAAAA
CACAGAAGCGTTGAAGCCATTAAAAGACCGCCGTTTTATTCAGATCGATCGAGATAACTTTGACGATGTA
CTCAAAAAAATGAATCCATCGGTGAAGTTTAAAGTTGCGAATAAGCTTGCGAATGACGATTCACAGTTTG
AGGTCGATTTAAACTTTAAATCAATGCAAGACTTTGAGCCTGCTGCGATCGTAAATCAAGTTGATCCACT
ACGCCAATTGATGGAAACGCGTAATAAACTGCGTGATTTGATGACAAAAGTTGACCGCTCAGAAGAGCTT
GAAAATATCCTAGAGGATGTTTTGAACAATACGGACAATCTGGCAAGACTTGCAGGCGAGTTAGATCTTG
ACAAGAAAGCGAAGTCAGACAGTACTGAAGGAGCGGAATAA