SecReT6
Protein ID: 225382182
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0616
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]17426..18919 [+]
Producthypothetical protein
NoteTssC
UniProt IDC0LZQ6, C0LZQ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-182, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|225382182|ref|ACN89322.1| hypothetical protein [Vibrio alginolyticus]
MTTEAEKQLDPTVNEQTTSFLDQAIGATKQTEASRAEELIKTLAEEAMKGTVTWNKNLTVTFREAINLLD
RQISDQLSEVMHYPELQKLEGSWRGLNYLVMNSETSSTLKVRMMSMTKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATAPVEEFGFEEFEVDPVSGIAVNAEHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEATANAAISARLPYMMATSRFAHYLKVMARVKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGAPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0616|:17426-18919
ATGACGACTGAAGCTGAAAAACAGTTAGATCCAACAGTTAATGAACAGACAACTTCATTCTTAGATCAAG
CTATTGGTGCAACTAAGCAGACCGAAGCTTCTCGTGCTGAGGAGCTGATTAAAACGCTCGCTGAAGAAGC
AATGAAAGGGACAGTTACTTGGAACAAAAACCTAACAGTAACTTTTCGTGAAGCGATTAATTTGCTCGAT
AGGCAGATTTCTGATCAGTTGTCTGAAGTAATGCATTACCCAGAATTACAGAAACTCGAAGGTTCTTGGC
GCGGCTTAAATTATCTAGTGATGAATTCAGAGACCAGCTCTACTCTGAAAGTTCGCATGATGAGTATGAC
CAAGAAAGAGCTACATAAAGACTTGAGCAAAGCTGTTGAGTTTGATCAAAGCCAGATCTTTAAAAAGGTT
TACGAGTCTGAGTTTGGTAGTGCTGGTGGTGAACCGTATGGTGCATTGATTGGAGACTATGAGTTTACCA
ACCACCCAGAAGATATTGAGTCGTTACGCCTAATGTCAAATGTAGCGGCTTCTGGCTTCTCTCCATTCTT
GTCCGCGGCTTCACCAGCACTATTCGGCTTTGATGAGTGGACTGAGCTGTCAAAACCACGCGACCTAGAT
AAGGTATTTGAATCACTAGAATACGCCCAATGGCGTTCGTTCCGCGAGAGTGCCGATTCGCGCTTCGTTA
GTCTGACGATGCCAAAAGTCCTTGCTCGTTTGCCATACGGACAAGCTACCGCTCCAGTCGAAGAGTTTGG
GTTTGAAGAGTTCGAAGTAGATCCTGTTTCAGGTATTGCTGTTAACGCTGAACATAACGACTACTGTTGG
ATGAACTCTTCGTATGTTCTTGGTGTTAAGTTAACTGACGCATTTTCAAAATATGGATTTTGTACTGCCA
TCCGTGGTGCAGAAGGCGGCGGTCGAGTGGATAACTTGCCAACGCATTTCTTCATGAGTGATGATGGCGA
CCCTGATATGAAGTGCCCAACAGAGATTGGTATTACCGACAGACGTGAGGCGGAGCTTGGTAAGCTTGGT
TTCTTACCGCTTTGTCACTACAAAAACACCAACTATGCAGTGTTCTTTGGTGCGCAAACCTGTCAAAAAC
CAGCGAACCATGAATCCCCTGAAGCAACGGCCAATGCGGCTATTTCTGCCCGCCTACCTTATATGATGGC
AACATCTCGTTTTGCGCATTATTTGAAAGTAATGGCTCGAGTTAAAATTGGTAGCTTTATGGAAGCAGAA
GACGTTGAGTCTTGGCTGAACCGCTGGATCCTAGGTTACGTCAATGCTTCTGAAGGCGGTGGTCAAGAGA
TCAGAGCGAAATACCCTCTAGCAGACGCTCGTGTTCAGGTTAAGGAAATTCCTGGCGCACCTGGTTCTTA
CAATGCCGTAGCATGGCTGAAACCTTGGTTGCAAATGGAAGAACTGACGACATCTTTGCGACTTGTGGCC
AAGATCCCTCAGTCAGGTGGATAA